Anti-KLK3 Antibody

kallikrein-related peptidase 3
Recommended Applications
Product Description
Polyclonal Antibody against Human KLK3
Alternative Gene Names
APS, PSA
Price
$437.00
Product Number
HPA000764
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
kallikrein-related peptidase 3
Target gene
KLK3
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000044485 (63%)

Rat ENSRNOG00000032857 (62%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:2500 - 1:5000

Retrieval method: HIER pH6

Protocols
Protein Name
kallikrein-related peptidase 3
Gene Name
KLK3
Alternative Gene Names
APS, PSA
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000142515 on the Human Protein Atlas

Barfeld SJ, Urbanucci A, Itkonen HM, Fazli L, Hicks JL, Thiede B, Rennie PS, Yegnasubramanian S, DeMarzo AM, Mills IG

c-Myc Antagonises the Transcriptional Activity of the Androgen Receptor in Prostate Cancer Affecting Key Gene Networks

EBioMedicine , 2017 Apr 5; 18:83-93. Epub 2017 Apr 5

PubMed ID: 28412251 DOI: 10.1016/j.ebiom.2017.04.006

OKATO A, GOTO Y, KUROZUMI A, KATO M, KOJIMA S, MATSUSHITA R, YONEMORI M, MIYAMOTO K, ICHIKAWA T, SEKI N

Direct regulation of LAMP1 by tumor-suppressive microRNA-320a in prostate cancer

Int J Oncol , 2016 May 16; 49(1):111-122. Epub 2016 May 16

PubMed ID: 27212625 DOI: 10.3892/ijo.2016.3522

Yusuke Goto, Satoko Kojima, Rika Nishikawa, Akira Kurozumi, Mayuko Kato, Hideki Enokida, Ryosuke Matsushita, Kazuto Yamazaki, Yasuo Ishida, Masayuki Nakagawa, Yukio Naya, Tomohiko Ichikawa, Naohiko Seki

MicroRNA expression signature of castration-resistant prostate cancer: the microRNA-221/222 cluster functions as a tumour suppressor and disease progression marker

British Journal of Cancer , September 01, 2015

PubMed ID: 0 DOI: 10.1038/bjc.2015.300

Liu H, Zhang W, Jia Y, Yu Q, Grau GE, Peng L, Ran Y, Yang Z, Deng H, Lou J

Single-cell clones of liver cancer stem cells have the potential of differentiating into different types of tumor cells

Cell Death Dis , 2013 Oct 17; 4(10):e857-. Epub 2013 Oct 17

PubMed ID: 24136221 DOI: 10.1038/cddis.2013.340

Jaraj SJ, Augsten M, Häggarth L, Wester K, Pontén F, Ostman A, Egevad L

GAD1 is a biomarker for benign and malignant prostatic tissue.

Scand J Urol Nephrol , 2011 Feb; 45(1):39-45. Epub 2010 Nov 22

PubMed ID: 21091088 DOI: 10.3109/00365599.2010.521189

Did we miss your publication?

Have you published using HPA000764? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch