Anti-KLF5 Antibody

Kruppel-like factor 5 (intestinal)
Recommended Applications
Product Description
Polyclonal Antibody against Human KLF5
Alternative Gene Names
BTEB2, CKLF, IKLF
Price
$437.00
Product Number
HPA040398
Unit Size
100 µl
Concentration
Lot dependent
Availability
6 in Stock
Ships
Ready to Ship
Target protein
Kruppel-like factor 5 (intestinal)
Target gene
KLF5
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TYTMPSQFLPQQATYFPPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVNSQNIQPVRYNRRSNPDLEKRRIHYCDYPGCTK
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000008785 (96%)

Mouse ENSMUSG00000005148 (93%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
Kruppel-like factor 5 (intestinal)
Gene Name
KLF5
Alternative Gene Names
BTEB2, CKLF, IKLF
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000102554 on the Human Protein Atlas

Fu RJ, He W, Wang XB, Li L, Zhao HB, Liu XY, Pang Z, Chen GQ, Huang L, Zhao KW

DNMT1-maintained hypermethylation of Krüppel-like factor 5 involves in the progression of clear cell renal cell carcinoma

Cell Death Dis , 2017 Jul 27; 8(7):e2952-. Epub 2017 Jul 27

PubMed ID: 28749461 DOI: 10.1038/cddis.2017.323

Zimmerlin L, Park TS, Huo JS, Verma K, Pather SR, Talbot CC Jr, Agarwal J, Steppan D, Zhang YW, Considine M, Guo H, Zhong X, Gutierrez C, Cope L, Canto-Soler MV, Friedman AD, Baylin SB, Zambidis ET

Tankyrase inhibition promotes a stable human naïve pluripotent state with improved functionality

Development , 2016 Dec 1; 143(23):4368-4380

PubMed ID: 27660325 DOI: 10.1242/dev.138982

Did we miss your publication?

Have you published using HPA040398? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch