Polyclonal Anti-KIF5A Antibody

kinesin family member 5A
Recommended Applications
Product Description
Polyclonal Antibody against Human KIF5A
Alternative Gene Names
D12S1889, MY050, NKHC, SPG10
Price
$505.00
Product Number
HPA004469
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
kinesin family member 5A
Target Gene
KIF5A
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
AQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQ
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000074657 (91%)

Rat ENSRNOG00000005299 (88%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
kinesin family member 5A
Gene Name
KIF5A
Alternative Gene Names
D12S1889, MY050, NKHC, SPG10
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000155980 on the Human Protein Atlas

Roman A Romanov, Amit Zeisel, Joanne Bakker, Fatima Girach, Arash Hellysaz, Raju Tomer, Alán Alpár, Jan Mulder, Frédéric Clotman, Erik Keimpema, Brian Hsueh, Ailey K Crow, Henrik Martens, Christian Schwindling, Daniela Calvigioni, Jaideep S Bains, Zoltán Máté, Gábor Szabó, Yuchio Yanagawa, Ming-Dong Zhang, Andre Rendeiro, Matthias Farlik, Mathias Uhlén, Peer Wulff, Christoph Bock, Christian Broberger, Karl Deisseroth, Tomas Hökfelt, Sten Linnarsson, Tamas L Horvath, Tibor Harkany

Molecular interrogation of hypothalamic organization reveals distinct dopamine neuronal subtypes

Nature Neuroscience , December 19, 2016

PubMed ID: None DOI: 10.1038/nn.4462

Did we miss your publication?

Have you published using HPA004469? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch