Enhanced Validation

Anti-KDM6A Antibody

lysine (K)-specific demethylase 6A
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human KDM6A
Alternative Gene Names
UTX
Price
$445.00
Product Number
HPA002111
Unit Size
Concentration
Lot dependent
Availability
6 in Stock
Ships
Ready to Ship
Target Protein
lysine (K)-specific demethylase 6A
Target Gene
KDM6A
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000037369 (95%)

Rat ENSRNOG00000052721 (94%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
lysine (K)-specific demethylase 6A
Gene Name
KDM6A
Alternative Gene Names
UTX
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000147050 on the Human Protein Atlas

Ramakrishnan S, Granger V, Rak M, Hu Q, Attwood K, Aquila L, Krishnan N, Osiecki R, Azabdaftari G, Guru K, Chatta G, Gueron G, McNally L, Ohm J, Wang J, Woloszynska A

Inhibition of EZH2 induces NK cell-mediated differentiation and death in muscle-invasive bladder cancer

Cell Death Differ , 2019 Jan 28; 26(10):2100-2114. Epub 2019 Jan 28

PubMed ID: 30692641 DOI: 10.1038/s41418-019-0278-9

Yoo KH, Oh S, Kang K, Wang C, Robinson GW, Ge K, Hennighausen L

Histone Demethylase KDM6A Controls the Mammary Luminal Lineage through Enzyme-Independent Mechanisms

Mol Cell Biol , 2016 Jul 29; 36(16):2108-2120. Epub 2016 Jul 29

PubMed ID: 27215382 DOI: 10.1128/MCB.00089-16

Did we miss your publication?

Have you published using HPA002111? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch