Anti-KDM4A Antibody

lysine (K)-specific demethylase 4A
Recommended Applications
Product Description
Polyclonal Antibody against Human KDM4A
Alternative Gene Names
JHDM3A, JMJD2, JMJD2A, KIAA0677, TDRD14A
Price
$445.00
Product Number
HPA007610
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
lysine (K)-specific demethylase 4A
Target Gene
KDM4A
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLKESELPPRAGNEEECPEEDMEGVEDGEEGDLKTSLAKHRIGTKRHRVCLEIPQEVSQSELFPKEDLSSEQYEMTEC
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000019956 (88%)

Mouse ENSMUSG00000033326 (84%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
lysine (K)-specific demethylase 4A
Gene Name
KDM4A
Alternative Gene Names
JHDM3A, JMJD2, JMJD2A, KIAA0677, TDRD14A
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000066135 on the Human Protein Atlas

Kader Salifou, Swagat Ray, Laure Verrier, Marion Aguirrebengoa, Didier Trouche, Konstantin I. Panov, Marie Vandromme

The histone demethylase JMJD2A/KDM4A links ribosomal RNA transcription to nutrients and growth factors availability

Nature Communications , 7, (2016)

PubMed ID: 0 DOI: 10.1038/ncomms10174

Dikopoltsev E, Foltyn VN, Zehl M, Jensen ON, Mori H, Radzishevsky I, Wolosker H

FBXO22 Protein Is Required for Optimal Synthesis of the N-Methyl-d-Aspartate (NMDA) Receptor Coagonist d-Serine

J Biol Chem , 2014 Dec 5; 289(49):33904-33915. Epub 2014 Oct 21

PubMed ID: 25336657 DOI: 10.1074/jbc.M114.618405

Verrier L, Escaffit F, Chailleux C, Trouche D, Vandromme M

A New Isoform of the Histone Demethylase JMJD2A/KDM4A Is Required for Skeletal Muscle Differentiation

PLoS Genet , 2011 Jun; 7(6):e1001390. Epub 2011 Jun 2

PubMed ID: 21694756 DOI: 10.1371/journal.pgen.1001390

Did we miss your publication?

Have you published using HPA007610? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch