Anti-KCNJ15 Antibody

potassium inwardly-rectifying channel, subfamily J, member 15
Recommended Applications
Product Description
Polyclonal Antibody against Human KCNJ15
Alternative Gene Names
IRKK, Kir1.3, Kir4.2
Price
$437.00
Product Number
HPA016702
Unit Size
100 µl
Concentration
Lot dependent
Availability
On Demand
Ships
On Demand
Target protein
potassium inwardly-rectifying channel, subfamily J, member 15
Target gene
KCNJ15
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKYRQEDQRERELRTL
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000062609 (96%)

Rat ENSRNOG00000001656 (96%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Protein Name
potassium inwardly-rectifying channel, subfamily J, member 15
Gene Name
KCNJ15
Alternative Gene Names
IRKK, Kir1.3, Kir4.2
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000157551 on the Human Protein Atlas

Liu Y, Wang H, Ni B, Zhang J, Li S, Huang Y, Cai Y, Mei H, Li Z

Loss of KCNJ15 expression promotes malignant phenotypes and correlates with poor prognosis in renal carcinoma

Cancer Manag Res , 2019 Feb 7; 11:1211-1220. Epub 2019 Feb 7

PubMed ID: 30799948 DOI: 10.2147/CMAR.S184368

He W, Liu W, Chew CS, Baker SS, Baker RD, Forte JG, Zhu L

Acid secretion-associated translocation of KCNJ15 in gastric parietal cells

Am J Physiol Gastrointest Liver Physiol , 2011 Oct; 301(4):G591-G600. Epub 2011 Jun 30

PubMed ID: 21719736 DOI: 10.1152/ajpgi.00460.2010

Did we miss your publication?

Have you published using HPA016702? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens