Anti-ITGB8 Antibody

integrin, beta 8
References (2)
Recommended Applications
Product Description
Polyclonal Antibody against Human ITGB8
Open Datasheet
Price
$450.00
Product Number
HPA027796
Unit Size
Concentration
Lot dependent
Availability
On Demand
Ships
On Demand
Show all images
[2 pictures]
Western blot analysis in human eye tissue.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.

Additional Images

See additional ICC images using this antibody on the Human Protein Atlas
Target Protein
integrin, beta 8
Target Gene
ITGB8
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAVHRQKISGNIDTPEGGFDAMLQAAVCESHIG
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000025321 (100%)

Rat ENSRNOG00000006569 (100%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA027796 on the Human Protein Atlas
Protein Name
integrin, beta 8
Gene Name
ITGB8
UniProt ID
P26012
Gene (Ensembl)
ENSG00000105855
Entrez Gene ID
Entrez gene: 3696
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000105855 on the Human Protein Atlas

Kumar V, Soni UK, Maurya VK, Singh K, Jha RK

Integrin beta8 (ITGB8) activates VAV-RAC1 signaling via FAK in the acquisition of endometrial epithelial cell receptivity for blastocyst implantation

Sci Rep , 2017 May 15; 7:1885. Epub 2017 May 15

PubMed ID: 28507287 DOI: 10.1038/s41598-017-01764-7

Did we miss your publication?

Have you published using HPA027796? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Anti-ITGB8 (AMAb91467)
Anti-ITGB8 (HPA027797)
Corresponding Antigens
PrEST Antigen ITGB8 (APrEST78061)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch