Polyclonal Anti-ITGB6 Antibody

integrin, beta 6
References (5)
Recommended Applications
Product Description
Polyclonal Antibody against Human ITGB6
Open Datasheet
Price
$459.00
Product Number
HPA023626
Unit Size
Concentration
Lot dependent
Availability
8 in Stock
Ships
Ready to Ship
Show all images
[1 pictures]
Immunohistochemical staining of human rectum shows strong cytoplasmic and membranous positivity in granular pattern in glandular cells.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line RT4 shows localization to nucleoplasm & cell junctions.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
integrin, beta 6
Target Gene
ITGB6
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RGDCVCGKCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSI
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000026971 (90%)

Rat ENSRNOG00000008346 (88%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Protein Name
integrin, beta 6
Gene Name
ITGB6
UniProt ID
P18564
Gene (Ensembl)
ENSG00000115221
Entrez Gene ID
Entrez gene: 3694
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000115221 on the Human Protein Atlas

Pătru A, Şurlin V, Mărgăritescu C, Ciucă EM, Matei M, Şerbănescu MS, Camen A

Analysis of the distribution and expression of some tumor invasiveness markers in palate squamous cell carcinomas

Rom J Morphol Embryol , 2021 Jun 22; 61(4):1259-1278. Epub 2021 Jun 22

PubMed ID: 34171074 DOI: 10.47162/RJME.61.4.27

Kemper M, Schiecke A, Maar H, Nikulin S, Poloznikov A, Galatenko V, Tachezy M, Gebauer F, Lange T, Riecken K, Tonevitsky A, Aigner A, Izbicki J, Schumacher U, Wicklein D

Integrin alpha-V is an important driver in pancreatic adenocarcinoma progression

J Exp Clin Cancer Res , 2021 Jun 26; 40:214. Epub 2021 Jun 26

PubMed ID: 34174926 DOI: 10.1186/s13046-021-01946-2

Byström S, Eklund M, Hong MG, Fredolini C, Eriksson M, Czene K, Hall P, Schwenk JM, Gabrielson M

Affinity proteomic profiling of plasma for proteins associated to area-based mammographic breast density

Breast Cancer Res , 2018 Feb 14; 20:14. Epub 2018 Feb 14

PubMed ID: 29444691 DOI: 10.1186/s13058-018-0940-z

Wang SK, Choi M, Richardson AS, Reid BM, Lin BP, Wang SJ, Kim JW, Simmer JP, Hu JC

ITGB6 loss-of-function mutations cause autosomal recessive amelogenesis imperfecta

Hum Mol Genet , 2014 Apr 15; 23(8):2157-2163. Epub 2013 Dec 4

PubMed ID: 24305999 DOI: 10.1093/hmg/ddt611

Did we miss your publication?

Have you published using HPA023626? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens
PrEST Antigen ITGB6 (APrEST70079)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch