Anti-ITGA8 Antibody

integrin, alpha 8
Recommended Applications
Product Description
Polyclonal Antibody against Human ITGA8
Price
$445.00
Product Number
HPA003432
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target Protein
integrin, alpha 8
Target Gene
ITGA8
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
HKEEEVGPLVEHIYELHNIGPSTISDTILEVGWPFSARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPAASPEDTPELSAFLRNSTIPHLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000016538 (91%)

Mouse ENSMUSG00000026768 (91%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Protocols
Protein Name
integrin, alpha 8
Gene Name
ITGA8
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000077943 on the Human Protein Atlas

Fukuzawa R, Anaka MR, Morison IM, Reeve AE

The developmental programme for genesis of the entire kidney is recapitulated in Wilms tumour

PLoS One , 2017 Oct 17; 12(10):e0186333. Epub 2017 Oct 17

PubMed ID: 29040332 DOI: 10.1371/journal.pone.0186333

Talbot JC, Nichols JT, Yan YL, Leonard IF, BreMiller RA, Amacher SL, Postlethwait JH, Kimmel CB

Pharyngeal morphogenesis requires fras1-itga8-dependent epithelial-mesenchymal interaction

Dev Biol , 2016 Jun 2; 416(1):136-148. Epub 2016 Jun 2

PubMed ID: 27265864 DOI: 10.1016/j.ydbio.2016.05.035

Did we miss your publication?

Have you published using HPA003432? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch