Enhanced Validation

Anti-ITGA6 Antibody

integrin, alpha 6
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human ITGA6
Alternative Gene Names
CD49f
Price
$445.00
Product Number
HPA012696
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
integrin, alpha 6
Target Gene
ITGA6
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
APYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSS
Verified Species Reactivity
Human, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000027111 (88%)

Rat ENSRNOG00000001518 (86%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Protein Name
integrin, alpha 6
Gene Name
ITGA6
Alternative Gene Names
CD49f
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000091409 on the Human Protein Atlas

Koshizuka K, Nohata N, Hanazawa T, Kikkawa N, Arai T, Okato A, Fukumoto I, Katada K, Okamoto Y, Seki N

Deep sequencing-based microRNA expression signatures in head and neck squamous cell carcinoma: dual strands of pre-miR-150 as antitumor miRNAs

Oncotarget , 2017 Mar 17; 8(18):30288-30304. Epub 2017 Mar 17

PubMed ID: 28415821 DOI: 10.18632/oncotarget.16327

André Filipe Vieira, Maria Rita Dionísio, Madalena Gomes, Jorge F Cameselle-Teijeiro, Manuela Lacerda, Isabel Amendoeira, Fernando Schmitt, Joana Paredes

P-cadherin: a useful biomarker for axillary-based breast cancer decisions in the clinical practice

Modern Pathology , January 13, 2017

PubMed ID: None DOI: 10.1038/modpathol.2016.232

Zhang DH, Yang ZL, Zhou EX, Miao XY, Zou Q, Li JH, Liang LF, Zeng GX, Chen SL

Overexpression of Thy1 and ITGA6 is associated with invasion, metastasis and poor prognosis in human gallbladder carcinoma

Oncol Lett , 2016 Nov 2; 12(6):5136-5144. Epub 2016 Nov 2

PubMed ID: 28105220 DOI: 10.3892/ol.2016.5341

Schlage P, Kockmann T, Sabino F, Kizhakkedathu JN, auf dem Keller U

Matrix Metalloproteinase 10 Degradomics in Keratinocytes and Epidermal Tissue Identifies Bioactive Substrates With Pleiotropic Functions

Mol Cell Proteomics , 2015 Oct 16; 14(12):3234-3246. Epub 2015 Oct 16

PubMed ID: 26475864 DOI: 10.1074/mcp.M115.053520

Sukhdeo K, Paramban RI, Vidal JG, Elia J, Martin J, Rivera M, Carrasco DR, Jarrar A, Kalady MF, Carson CT, Balderas R, Hjelmeland AB, Lathia JD, Rich JN

Multiplex Flow Cytometry Barcoding and Antibody Arrays Identify Surface Antigen Profiles of Primary and Metastatic Colon Cancer Cell Lines

PLoS One , 2013; 8(1):e53015. Epub 2013 Jan 7

PubMed ID: 23308131 DOI: 10.1371/journal.pone.0053015

Kielosto M, Nummela P, Järvinen K, Yin M, Hölttä E

Identification of integrins alpha6 and beta7 as c-Jun- and transformation-relevant genes in highly invasive fibrosarcoma cells.

Int J Cancer , 2009 Sep 1; 125(5):1065-73

PubMed ID: 19405119 DOI: 10.1002/ijc.24391

Did we miss your publication?

Have you published using HPA012696? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch