Enhanced Validation

Anti-ILF2 Antibody

interleukin enhancer binding factor 2
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human ILF2
Alternative Gene Names
NF45
Price
$445.00
Product Number
HPA007484
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
interleukin enhancer binding factor 2
Target Gene
ILF2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATV
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000001016 (100%)

Rat ENSRNOG00000014154 (100%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
interleukin enhancer binding factor 2
Gene Name
ILF2
Alternative Gene Names
NF45
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000143621 on the Human Protein Atlas

Bremer HD, Landegren N, Sjöberg R, Hallgren Å, Renneker S, Lattwein E, Leonard D, Eloranta ML, Rönnblom L, Nordmark G, Nilsson P, Andersson G, Lilliehöök I, Lindblad-Toh K, Kämpe O, Hansson-Hamlin H

ILF2 and ILF3 are autoantigens in canine systemic autoimmune disease

Sci Rep , 2018 Mar 19; 8:4852. Epub 2018 Mar 19

PubMed ID: 29556082 DOI: 10.1038/s41598-018-23034-w

Cheng S, Jiang X, Ding C, Du C, Owusu-Ansah KG, Weng X, Hu W, Peng C, Lv Z, Tong R, Xiao H, Xie H, Zhou L, Wu J, Zheng S

Expression and Critical Role of Interleukin Enhancer Binding Factor 2 in Hepatocellular Carcinoma

Int J Mol Sci , 2016 Aug 22; 17(8):1373. Epub 2016 Aug 22

PubMed ID: 27556459 DOI: 10.3390/ijms17081373

Did we miss your publication?

Have you published using HPA007484? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch