Polyclonal Anti-IL7 Antibody

interleukin 7
References (3)
Recommended Applications
Product Description
Polyclonal Antibody against Human IL7
Alternative Gene Names
IL-7
Open Datasheet
Price
$505.00
Product Number
HPA019590
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[4 pictures]
Immunohistochemical staining of human Stomach shows strong cytoplasmic and membranous positivity in glandular cells.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
interleukin 7
Target Gene
IL7
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEI
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000040329 (46%)

Rat ENSRNOG00000011973 (46%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Protocols
View all protocols
Protein Name
interleukin 7
Gene Name
IL7
Alternative Gene Names
IL-7
UniProt ID
P13232
Gene (Ensembl)
ENSG00000104432
Entrez Gene ID
Entrez gene: 3574
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000104432 on the Human Protein Atlas

Månberg A, Bradley F, Qundos U, Guthrie BL, Birse K, Noël-Romas L, Lindskog C, Bosire R, Kiarie J, Farquhar C, Burgener AD, Nilsson P, Broliden K

A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection

Mol Cell Proteomics , 2019 Mar; 18(3):461-476

PubMed ID: 30504243 DOI: 10.1074/mcp.RA118.000757

Bachmann J, Burté F, Pramana S, Conte I, Brown BJ, Orimadegun AE, Ajetunmobi WA, Afolabi NK, Akinkunmi F, Omokhodion S, Akinbami FO, Shokunbi WA, Kampf C, Pawitan Y, Uhlén M, Sodeinde O, Schwenk JM, Wahlgren M, Fernandez-Reyes D, Nilsson P

Affinity Proteomics Reveals Elevated Muscle Proteins in Plasma of Children with Cerebral Malaria

PLoS Pathog , 2014 Apr; 10(4):e1004038. Epub 2014 Apr 17

PubMed ID: 24743550 DOI: 10.1371/journal.ppat.1004038

Did we miss your publication?

Have you published using HPA019590? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-IL7 (AMAb91684)
Corresponding Antigens
PrEST Antigen IL7 (APrEST74075)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch