Polyclonal Anti-IGSF9B Antibody

immunoglobulin superfamily, member 9B
References (3)
Recommended Applications
Product Description
Polyclonal Antibody against Human IGSF9B
Alternative Gene Names
KIAA1030
Open Datasheet
Price
$459.00
Product Number
HPA010802
Unit Size
Concentration
Lot dependent
Availability
1 in Stock
Ships
Ready to Ship
Show all images
[4 pictures]
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
immunoglobulin superfamily, member 9B
Target Gene
IGSF9B
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LEAPLSSGKVSPESIRTLRAPSESSDDQGQPAAKRMLSPTREKELSLYKKTKRAISSKKYSVAKAEAEAEATTPIELISRGPDGRFVMDPAEMEPSLKSRRIEGFPFAEETDMYPEFRQSDEENEDPLVPTSVAALKSQLTPLSSSQE
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000009253 (94%)

Mouse ENSMUSG00000034275 (94%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Protocols
View all protocols
Protein Name
immunoglobulin superfamily, member 9B
Gene Name
IGSF9B
Alternative Gene Names
KIAA1030
UniProt ID
Q9UPX0
Gene (Ensembl)
ENSG00000080854
Entrez Gene ID
Entrez gene: 22997
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000080854 on the Human Protein Atlas

Babaev O, Cruces-Solis H, Piletti Chatain C, Hammer M, Wenger S, Ali H, Karalis N, de Hoz L, Schlüter OM, Yanagawa Y, Ehrenreich H, Taschenberger H, Brose N, Krueger-Burg D

IgSF9b regulates anxiety behaviors through effects on centromedial amygdala inhibitory synapses

Nat Commun , 2018 Dec 20; 9:5400. Epub 2018 Dec 20

PubMed ID: 30573727 DOI: 10.1038/s41467-018-07762-1

Woo J, Kwon SK, Nam J, Choi S, Takahashi H, Krueger D, Park J, Lee Y, Bae JY, Lee D, Ko J, Kim H, Kim MH, Bae YC, Chang S, Craig AM, Kim E

The adhesion protein IgSF9b is coupled to neuroligin 2 via S-SCAM to promote inhibitory synapse development

J Cell Biol , 2013 Jun 10; 201(6):929-944

PubMed ID: 23751499 DOI: 10.1083/jcb.201209132

Did we miss your publication?

Have you published using HPA010802? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-IGSF9B (HPA010744)
Corresponding Antigens
PrEST Antigen IGSF9B (APrEST71672)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch