Enhanced Validation

Polyclonal Anti-IFI16 Antibody

interferon, gamma-inducible protein 16
References (5)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human IFI16
Alternative Gene Names
IFNGIP1, PYHIN2
Open Datasheet
Price
$505.00
Product Number
HPA002134
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using HPA002134 antibody. Corresponding IFI16 RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Western blot analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-IFI16 antibody. Corresponding IFI16 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & nucleoli.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
interferon, gamma-inducible protein 16
Target Gene
IFI16
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KEKFTPKKIIAIANYVCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIK
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000039997 (53%)

Rat ENSRNOG00000003480 (39%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA002134 on the Human Protein Atlas
Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA002134 on the Human Protein Atlas
Protein Name
interferon, gamma-inducible protein 16
Gene Name
IFI16
Alternative Gene Names
IFNGIP1, PYHIN2
UniProt ID
Q16666
Gene (Ensembl)
ENSG00000163565
Entrez Gene ID
Entrez gene: 3428
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000163565 on the Human Protein Atlas

Krump NA, Wang R, Liu W, Yang JF, Ma T, You J

Merkel Cell Polyomavirus Infection Induces an Antiviral Innate Immune Response in Human Dermal Fibroblasts

J Virol , 2021 Jun 10; 95(13):e02211-20. Epub 2021 Jun 10

PubMed ID: 33883226 DOI: 10.1128/JVI.02211-20

Hyun J, McMahon RS, Lang AL, Edwards JS, Badilla AD, Greene ME, Stone GW, Pallikkuth S, Stevenson M, Dykxhoorn DM, Kottilil S, Pahwa S, Thomas E

HIV and HCV augments inflammatory responses through increased TREM-1 expression and signaling in Kupffer and Myeloid cells

PLoS Pathog , 2019 Jul 1; 15(7):e1007883. Epub 2019 Jul 1

PubMed ID: 31260499 DOI: 10.1371/journal.ppat.1007883

Farshchian M, Nissinen L, Siljamäki E, Riihilä P, Piipponen M, Kivisaari A, Kallajoki M, Grénman R, Peltonen J, Peltonen S, Quint KD, Bavinck JN, Kähäri VM

Tumor cell-specific AIM2 regulates growth and invasion of cutaneous squamous cell carcinoma

Oncotarget , 2017 May 2; 8(28):45825-45836. Epub 2017 May 2

PubMed ID: 28526809 DOI: 10.18632/oncotarget.17573

Iqbal J, Ansari MA, Kumar B, Dutta D, Roy A, Chikoti L, Pisano G, Dutta S, Vahedi S, Veettil MV, Chandran B

Histone H2B-IFI16 Recognition of Nuclear Herpesviral Genome Induces Cytoplasmic Interferon-β Responses

PLoS Pathog , 2016 Oct 20; 12(10):e1005967. Epub 2016 Oct 20

PubMed ID: 27764250 DOI: 10.1371/journal.ppat.1005967

Did we miss your publication?

Have you published using HPA002134? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens
PrEST Antigen IFI16 (APrEST85182)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch