Enhanced Validation

Polyclonal Anti-IDH1 Antibody

isocitrate dehydrogenase 1 (NADP+), soluble
References (1)
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human IDH1
Open Datasheet
Price
$505.00
Product Number
HPA057936
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[4 pictures]
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
Show all images
[1 pictures]
Western blot analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-IDH1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
isocitrate dehydrogenase 1 (NADP+), soluble
Target Gene
IDH1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000015020 (95%)

Mouse ENSMUSG00000025950 (92%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)
All IHC characterization data in 44 normal tissues and 20 cancers for HPA057936 on the Human Protein Atlas
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
isocitrate dehydrogenase 1 (NADP+), soluble
Gene Name
IDH1
UniProt ID
O75874
Gene (Ensembl)
ENSG00000138413
Entrez Gene ID
Entrez gene: 3417
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000138413 on the Human Protein Atlas

Did we miss your publication?

Have you published using HPA057936? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-IDH1 (AMAb90578)
Anti-IDH1 (HPA035248)
Corresponding Antigens
PrEST Antigen IDH1 (APrEST79090)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch