Enhanced Validation

Polyclonal Anti-IDH1 Antibody

isocitrate dehydrogenase 1 (NADP+), soluble
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human IDH1
Price
$459.00
Product Number
HPA035248
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
isocitrate dehydrogenase 1 (NADP+), soluble
Target Gene
IDH1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000015020 (95%)

Mouse ENSMUSG00000025950 (95%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
isocitrate dehydrogenase 1 (NADP+), soluble
Gene Name
IDH1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000138413 on the Human Protein Atlas

Dahuja G, Gupta A, Jindal A, Jain G, Sharma S, Kumar A

Clinicopathological Correlation of Glioma Patients with respect to Immunohistochemistry Markers: A Prospective Study of 115 Patients in a Tertiary Care Hospital in North India

Asian J Neurosurg , 2021 Dec 18; 16(4):732-737. Epub 2021 Dec 18

PubMed ID: 35071070 DOI: 10.4103/ajns.AJNS_377_20

van Lith SA, Navis AC, Lenting K, Verrijp K, Schepens JT, Hendriks WJ, Schubert NA, Venselaar H, Wevers RA, van Rooij A, Wesseling P, Molenaar RJ, van Noorden CJ, Pusch S, Tops B, Leenders WP

Identification of a novel inactivating mutation in Isocitrate Dehydrogenase 1 (IDH1-R314C) in a high grade astrocytoma

Sci Rep , 2016 Jul 27; 6:30486. Epub 2016 Jul 27

PubMed ID: 27460417 DOI: 10.1038/srep30486

O'Dwyer D, Ralton LD, O'Shea A, Murray GI

The Proteomics of Colorectal Cancer: Identification of a Protein Signature Associated with Prognosis

PLoS One , 2011; 6(11):e27718. Epub 2011 Nov 18

PubMed ID: 22125622 DOI: 10.1371/journal.pone.0027718

Did we miss your publication?

Have you published using HPA035248? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch