1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-HTR2B
Enhanced Validation

Anti-HTR2B Antibody

5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled
References (5)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human HTR2B
Alternative Gene Names
5-HT(2B), 5-HT2B
Open Datasheet
Price
$450.00
Product Number
HPA012867
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemistry analysis in human endometrium and skeletal muscle tissues using HPA012867 antibody. Corresponding HTR2B RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleoplasm.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled
Target Gene
HTR2B
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVL
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000026228 (77%)

Rat ENSRNOG00000017625 (77%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA012867 on the Human Protein Atlas
Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA012867 on the Human Protein Atlas
Protein Name
5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled
Gene Name
HTR2B
Alternative Gene Names
5-HT(2B), 5-HT2B
UniProt ID
P41595
Gene (Ensembl)
ENSG00000135914
Entrez Gene ID
Entrez gene: 3357
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000135914 on the Human Protein Atlas

Hirano D, Urabe Y, Tanaka S, Nakamura K, Ninomiya Y, Yuge R, Hayashi R, Oka S, Kitadai Y, Shimamoto F, Arihiro K, Chayama K

Early-stage serrated adenocarcinomas are divided into several molecularly distinct subtypes

PLoS One , 2019 Feb 20; 14(2):e0211477. Epub 2019 Feb 20

PubMed ID: 30785889 DOI: 10.1371/journal.pone.0211477

T T Vellinga, S den Uil, I H B Rinkes, D Marvin, B Ponsioen, A Alvarez-Varela, S Fatrai, C Scheele, D A Zwijnenburg, H Snippert, L Vermeulen, J P Medema, H B Stockmann, J Koster, R J A Fijneman, J de Rooij, O Kranenburg

Collagen-rich stroma in aggressive colon tumors induces mesenchymal gene expression and tumor cell invasion

Oncogene , March 21, 2016

PubMed ID: 0 DOI: 10.1038/onc.2016.60

Haley SA, O'Hara BA, Nelson CD, Brittingham FL, Henriksen KJ, Stopa EG, Atwood WJ

Human Polyomavirus Receptor Distribution in Brain Parenchyma Contrasts with Receptor Distribution in Kidney and Choroid Plexus

Am J Pathol , 2015 Jun 6; 185(8):2246-2258

PubMed ID: 26056932 DOI: 10.1016/j.ajpath.2015.04.003

De Sousa E Melo F, Wang X, Jansen M, Fessler E, Trinh A, de Rooij LP, de Jong JH, de Boer OJ, van Leersum R, Bijlsma MF, Rodermond H, van der Heijden M, van Noesel CJ, Tuynman JB, Dekker E, Markowetz F, Medema JP, Vermeulen L

Poor-prognosis colon cancer is defined by a molecularly distinct subtype and develops from serrated precursor lesions.

Nat Med , 2013 May; 19(5):614-8. Epub 2013 Apr 14

PubMed ID: 23584090 DOI: 10.1038/nm.3174

Did we miss your publication?

Have you published using HPA012867? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Anti-HTR2B (HPA063658)
Corresponding Antigens
PrEST Antigen HTR2B (APrEST72721)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch
  1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-HTR2B