Enhanced Validation

Anti-HOXA5 Antibody

homeobox A5
Recommended Applications
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human HOXA5
Alternative Gene Names
HOX1, HOX1C
Price
$445.00
Product Number
HPA029319
Unit Size
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target Protein
homeobox A5
Target Gene
HOXA5
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MHSGRYGYGYNGMDLSVGRSGSGHFGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSDSHHGGKNSLSNSSGASADAGSTHISSREGVGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDN
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000038253 (96%)

Rat ENSRNOG00000052804 (96%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Western Blot (WB)

Recombinant expression validation in WB using target protein overexpression.

Protein Name
homeobox A5
Gene Name
HOXA5
Alternative Gene Names
HOX1, HOX1C
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000106004 on the Human Protein Atlas

Gjyshi A, Dash S, Cen L, Cheng CH, Zhang C, Yoder SJ, Teer JK, Armaiz-Pena GN, Monteiro AN

Early transcriptional response of human ovarian and fallopian tube surface epithelial cells to norepinephrine

Sci Rep , 2018 May 29; 8:8291. Epub 2018 May 29

PubMed ID: 29844388 DOI: 10.1038/s41598-018-26670-4

Li CJ, Hong T, Tung YT, Yen YP, Hsu HC, Lu YL, Chang M, Nie Q, Chen JA

MicroRNA filters Hox temporal transcription noise to confer boundary formation in the spinal cord

Nat Commun , 2017 Mar 24; 8:14685. Epub 2017 Mar 24

PubMed ID: 28337978 DOI: 10.1038/ncomms14685

Did we miss your publication?

Have you published using HPA029319? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch