Enhanced Validation

Polyclonal Anti-HOPX Antibody

HOP homeobox
References (18)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human HOPX
Alternative Gene Names
HOP, LAGY, NECC1, OB1, SMAP31
Open Datasheet
Price
$505.00
Product Number
HPA030180
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[4 pictures]
Immunohistochemistry analysis in human skin and liver tissues using HPA030180 antibody. Corresponding HOPX RNA-seq data are presented for the same tissues.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
HOP homeobox
Target Gene
HOPX
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MLIFLGCYRRRLEERAGTMSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000059325 (74%)

Rat ENSRNOG00000024689 (74%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:2500 - 1:5000

Retrieval method: HIER pH6

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA030180 on the Human Protein Atlas
Protein Name
HOP homeobox
Gene Name
HOPX
Alternative Gene Names
HOP, LAGY, NECC1, OB1, SMAP31
UniProt ID
Q9BPY8
Gene (Ensembl)
ENSG00000171476
Entrez Gene ID
Entrez gene: 84525
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000171476 on the Human Protein Atlas

Liu Y, Bilen M, McNicoll MM, Harris RA, Fong BC, Iqbal MA, Paul S, Mayne J, Walker K, Wang J, Figeys D, Slack RS

Early postnatal defects in neurogenesis in the 3xTg mouse model of Alzheimer’s disease

Cell Death Dis , 2023 Feb 18; 14(2):138. Epub 2023 Feb 18

PubMed ID: 36801910 DOI: 10.1038/s41419-023-05650-1

Jones MR, Lingampally A, Ahmadvand N, Chong L, Wu J, Wilhem J, Vazquez-Armendariz AI, Ansari M, Herold S, Ornitz DM, Schiller HB, Chao CM, Zhang JS, Carraro G, Bellusci S

FGFR2b signalling restricts lineage-flexible alveolar progenitors during mouse lung development and converges in mature alveolar type 2 cells

Cell Mol Life Sci , 2022 Nov 29; 79(12):609. Epub 2022 Nov 29

PubMed ID: 36445537 DOI: 10.1007/s00018-022-04626-2

Fischer J, Ortuño EF, Marsoner F, Artioli A, Peters J, Namba T, Oegema CE, Huttner WB, Ladewig J, Heide M

Human-specific ARHGAP11B ensures human-like basal progenitor levels in hominid cerebral organoids

EMBO Rep , 2022 Sep 13; 23(11):e54728. Epub 2022 Sep 13

PubMed ID: 36381990 DOI: 10.15252/embr.202254728

Rosebrock D, Arora S, Mutukula N, Volkman R, Gralinska E, Balaskas A, Aragonés Hernández A, Buschow R, Brändl B, Müller FJ, Arndt PF, Vingron M, Elkabetz Y

Enhanced cortical neural stem cell identity through short SMAD and WNT inhibition in human cerebral organoids facilitates emergence of outer radial glial cells

Nat Cell Biol , 2022 Jun 13; 24(6):981-995. Epub 2022 Jun 13

PubMed ID: 35697781 DOI: 10.1038/s41556-022-00929-5

Zhu X, Guo Y, Chu C, Liu D, Duan K, Yin Y, Si C, Kang Y, Yao J, Du X, Li J, Zhao S, Ai Z, Zhu Q, Ji W, Niu Y, Li T

BRN2 as a key gene drives the early primate telencephalon development

Sci Adv , 2022 Mar 4; 8(9):eabl7263. Epub 2022 Mar 4

PubMed ID: 35245119 DOI: 10.1126/sciadv.abl7263

Zhao Z, Zhang D, Yang F, Xu M, Zhao S, Pan T, Liu C, Liu Y, Wu Q, Tu Q, Zhou P, Li R, Kang J, Zhu L, Gao F, Wang Y, Xu Z

Evolutionarily conservative and non-conservative regulatory networks during primate interneuron development revealed by single-cell RNA and ATAC sequencing

Cell Res , 2022 Mar 10; 32(5):425-436. Epub 2022 Mar 10

PubMed ID: 35273378 DOI: 10.1038/s41422-022-00635-9

Kyrousi C, O’Neill AC, Brazovskaja A, He Z, Kielkowski P, Coquand L, Di Giaimo R, D’ Andrea P, Belka A, Forero Echeverry A, Mei D, Lenge M, Cruceanu C, Buchsbaum IY, Khattak S, Fabien G, Binder E, Elmslie F, Guerrini R, Baffet AD, Sieber SA, Treutlein B, Robertson SP, Cappello S

Extracellular LGALS3BP regulates neural progenitor position and relates to human cortical complexity

Nat Commun , 2021 Nov 2; 12:6298. Epub 2021 Nov 2

PubMed ID: 34728600 DOI: 10.1038/s41467-021-26447-w

Kerimoglu C, Pham L, Tonchev AB, Sakib MS, Xie Y, Sokpor G, Ulmke PA, Kaurani L, Abbas E, Nguyen H, Rosenbusch J, Michurina A, Capece V, Angelova M, Maricic N, Brand-Saberi B, Esgleas M, Albert M, Minkov R, Kovachev E, Teichmann U, Seong RH, Huttner WB, Nguyen HP, Stoykova A, Staiger JF, Fischer A, Tuoc T

H3 acetylation selectively promotes basal progenitor proliferation and neocortex expansion

Sci Adv , 2021 Sep 15; 7(38):eabc6792. Epub 2021 Sep 15

PubMed ID: 34524839 DOI: 10.1126/sciadv.abc6792

Aygün N, Elwell AL, Liang D, Lafferty MJ, Cheek KE, Courtney KP, Mory J, Hadden-Ford E, Krupa O, de la Torre-Ubieta L, Geschwind DH, Love MI, Stein JL

Brain-trait-associated variants impact cell-type-specific gene regulation during neurogenesis

Am J Hum Genet , 2021 Aug 19; 108(9):1647-1668. Epub 2021 Aug 19

PubMed ID: 34416157 DOI: 10.1016/j.ajhg.2021.07.011

Liang D, Elwell AL, Aygün N, Krupa O, Wolter JM, Kyere FA, Lafferty MJ, Cheek KE, Courtney KP, Yusupova M, Garrett ME, Ashley-Koch A, Crawford GE, Love MI, de la Torre-Ubieta L, Geschwind DH, Stein JL

Cell-type specific effects of genetic variation on chromatin accessibility during human neuronal differentiation

Nat Neurosci , 2021 May 20; 24(7):941-953. Epub 2021 May 20

PubMed ID: 34017130 DOI: 10.1038/s41593-021-00858-w

Hou QQ, Xiao Q, Sun XY, Ju XC, Luo ZG

TBC1D3 promotes neural progenitor proliferation by suppressing the histone methyltransferase G9a

Sci Adv , 2021 Jan 15; 7(3):eaba8053. Epub 2021 Jan 15

PubMed ID: 33523893 DOI: 10.1126/sciadv.aba8053

Matsumoto N, Tanaka S, Horiike T, Shinmyo Y, Kawasaki H

A discrete subtype of neural progenitor crucial for cortical folding in the gyrencephalic mammalian brain

eLife , 2020 Apr 21; 9:e54873. Epub 2020 Apr 21

PubMed ID: 32312384 DOI: 10.7554/eLife.54873

Shao W, Yang J, He M, Yu XY, Lee CH, Yang Z, Joyner AL, Anderson KV, Zhang J, Bryan Tsou MF, Shi H, Shi SH

Centrosome anchoring regulates progenitor properties and cortical formation

Nature , 2020 Mar 25; 580(7801):106-112. Epub 2020 Mar 25

PubMed ID: 32238932 DOI: 10.1038/s41586-020-2139-6

Bendriem RM, Singh S, Aleem AA, Antonetti DA, Ross ME

Tight junction protein occludin regulates progenitor Self-Renewal and survival in developing cortex

eLife , 2019 Dec 3; 8:e49376. Epub 2019 Dec 3

PubMed ID: 31794381 DOI: 10.7554/eLife.49376

Velasco S, Kedaigle AJ, Simmons SK, Nash A, Rocha M, Quadrato G, Paulsen B, Nguyen L, Adiconis X, Regev A, Levin JZ, Arlotta P

Individual brain organoids reproducibly form cell diversity of the human cerebral cortex

Nature , 2019 Jun 5; 570(7762):523-527. Epub 2019 Jun 5

PubMed ID: 31168097 DOI: 10.1038/s41586-019-1289-x

Ju XC, Hou QQ, Sheng AL, Wu KY, Zhou Y, Jin Y, Wen T, Yang Z, Wang X, Luo ZG

The hominoid-specific gene TBC1D3 promotes generation of basal neural progenitors and induces cortical folding in mice

eLife , 2016 Aug 9; 5:e18197. Epub 2016 Aug 9

PubMed ID: 27504805 DOI: 10.7554/eLife.18197

Stadler C, Rexhepaj E, Singan VR, Murphy RF, Pepperkok R, Uhlén M, Simpson JC, Lundberg E

Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells.

Nat Methods , 2013 Apr; 10(4):315-23. Epub 2013 Feb 24

PubMed ID: 23435261 DOI: 10.1038/nmeth.2377

Did we miss your publication?

Have you published using HPA030180? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens
PrEST Antigen HOPX (APrEST78383)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch