Enhanced Validation

Anti-HOPX Antibody

HOP homeobox
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human HOPX
Alternative Gene Names
HOP, LAGY, NECC1, OB1, SMAP31
Price
$445.00
Product Number
HPA030180
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
HOP homeobox
Target Gene
HOPX
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MLIFLGCYRRRLEERAGTMSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000059325 (74%)

Rat ENSRNOG00000024689 (74%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:2500 - 1:5000

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
HOP homeobox
Gene Name
HOPX
Alternative Gene Names
HOP, LAGY, NECC1, OB1, SMAP31
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000171476 on the Human Protein Atlas

Matsumoto N, Tanaka S, Horiike T, Shinmyo Y, Kawasaki H

A discrete subtype of neural progenitor crucial for cortical folding in the gyrencephalic mammalian brain

eLife , 2020 Apr 21; 9:e54873. Epub 2020 Apr 21

PubMed ID: 32312384 DOI: 10.7554/eLife.54873

Bendriem RM, Singh S, Aleem AA, Antonetti DA, Ross ME

Tight junction protein occludin regulates progenitor Self-Renewal and survival in developing cortex

eLife , 2019 Dec 3; 8:e49376. Epub 2019 Dec 3

PubMed ID: 31794381 DOI: 10.7554/eLife.49376

Velasco S, Kedaigle AJ, Simmons SK, Nash A, Rocha M, Quadrato G, Paulsen B, Nguyen L, Adiconis X, Regev A, Levin JZ, Arlotta P

Individual brain organoids reproducibly form cell diversity of the human cerebral cortex

Nature , 2019 Jun 5; 570(7762):523-527. Epub 2019 Jun 5

PubMed ID: 31168097 DOI: 10.1038/s41586-019-1289-x

Ju XC, Hou QQ, Sheng AL, Wu KY, Zhou Y, Jin Y, Wen T, Yang Z, Wang X, Luo ZG

The hominoid-specific gene TBC1D3 promotes generation of basal neural progenitors and induces cortical folding in mice

eLife , 2016 Aug 9; 5:e18197. Epub 2016 Aug 9

PubMed ID: 27504805 DOI: 10.7554/eLife.18197

Stadler C, Rexhepaj E, Singan VR, Murphy RF, Pepperkok R, Uhlén M, Simpson JC, Lundberg E

Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells.

Nat Methods , 2013 Apr; 10(4):315-23. Epub 2013 Feb 24

PubMed ID: 23435261 DOI: 10.1038/nmeth.2377

Did we miss your publication?

Have you published using HPA030180? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch