Anti-HNRNPH2 Antibody

heterogeneous nuclear ribonucleoprotein H2 (H')
Recommended Applications
Product Description
Polyclonal Antibody against Human HNRNPH2
Alternative Gene Names
FTP3, hnRNPH', HNRPH', HNRPH2
Price
$445.00
Product Number
HPA001359
Unit Size
Concentration
Lot dependent
Availability
9 in Stock
Ships
Ready to Ship
Target Protein
heterogeneous nuclear ribonucleoprotein H2 (H')
Target Gene
HNRNPH2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DGRVTGEADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQ
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000045427 (100%)

Rat ENSRNOG00000011661 (99%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
heterogeneous nuclear ribonucleoprotein H2 (H')
Gene Name
HNRNPH2
Alternative Gene Names
FTP3, hnRNPH', HNRPH', HNRPH2
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000126945 on the Human Protein Atlas

Rappe U, Schlechter T, Aschoff M, Hotz-Wagenblatt A, Hofmann I

Nuclear ARVCF Protein Binds Splicing Factors and Contributes to the Regulation of Alternative Splicing

J Biol Chem , 2014 May 2; 289(18):12421-12434. Epub 2014 Mar 18

PubMed ID: 24644279 DOI: 10.1074/jbc.M113.530717

Did we miss your publication?

Have you published using HPA001359? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch