Enhanced Validation

Polyclonal Anti-HNF4G Antibody

hepatocyte nuclear factor 4, gamma
References (5)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human HNF4G
Alternative Gene Names
NR2A2
Open Datasheet
Price
$505.00
Product Number
HPA005438
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[3 pictures]
Immunohistochemistry analysis in human small intestine and liver tissues using Anti-HNF4G antibody. Corresponding HNF4G RNA-seq data are presented for the same tissues.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
hepatocyte nuclear factor 4, gamma
Target Gene
HNF4G
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
WQMIEQIQFVKLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQ
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000017688 (94%)

Rat ENSRNOG00000008971 (94%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA005438 on the Human Protein Atlas
Protein Name
hepatocyte nuclear factor 4, gamma
Gene Name
HNF4G
Alternative Gene Names
NR2A2
UniProt ID
Q14541
Gene (Ensembl)
ENSG00000164749
Entrez Gene ID
Entrez gene: 3174
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000164749 on the Human Protein Atlas

Che H, Zheng Q, Liao Z, Zhang L

HNF4G accelerates glioma progression by facilitating NRP1 transcription

Oncol Lett , 2023 Feb 1; 25(3):102. Epub 2023 Feb 1

PubMed ID: 36817051 DOI: 10.3892/ol.2023.13688

Lei X, Ketelut-Carneiro N, Shmuel-Galia L, Xu W, Wilson R, Vierbuchen T, Chen Y, Reboldi A, Kang J, Edelblum KL, Ward D, Fitzgerald KA

Epithelial HNF4A shapes the intraepithelial lymphocyte compartment via direct regulation of immune signaling molecules

J Exp Med , 2022 Jul 6; 219(8):e20212563. Epub 2022 Jul 6

PubMed ID: 35792863 DOI: 10.1084/jem.20212563

Lindeboom RG, van Voorthuijsen L, Oost KC, Rodríguez‐Colman MJ, Luna‐Velez MV, Furlan C, Baraille F, Jansen PW, Ribeiro A, Burgering BM, Snippert HJ, Vermeulen M

Integrative multi‐omics analysis of intestinal organoid differentiation

Mol Syst Biol , 2018 Jun 26; 14(6):e8227. Epub 2018 Jun 26

PubMed ID: 29945941 DOI: 10.15252/msb.20188227

Shukla S, Cyrta J, Murphy DA, Walczak EG, Ran L, Agrawal P, Xie Y, Chen Y, Wang S, Zhan Y, Li D, Wong WP, Sboner A, Beltran H, Mosquera JM, Sher J, Cao Z, Wongvipat J, Koche RP, Gopalan A, Zheng D, Rubin MA, Scher HI, Chi P, Chen Y

Aberrant activation of a gastrointestinal transcriptional circuit in prostate cancer mediates castration resistance

Cancer Cell , 2017 Nov 16; 32(6):792-806.e7. Epub 2017 Nov 16

PubMed ID: 29153843 DOI: 10.1016/j.ccell.2017.10.008

Did we miss your publication?

Have you published using HPA005438? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens
PrEST Antigen HNF4G (APrEST70753)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch