Enhanced Validation

Anti-HNF1B Antibody

HNF1 homeobox B
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human HNF1B
Alternative Gene Names
HNF1beta, LFB3, MODY5, TCF2, VHNF1
Price
$437.00
Product Number
HPA002083
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
HNF1 homeobox B
Target gene
HNF1B
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQH
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000002598 (97%)

Mouse ENSMUSG00000020679 (97%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
HNF1 homeobox B
Gene Name
HNF1B
Alternative Gene Names
HNF1beta, LFB3, MODY5, TCF2, VHNF1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000275410 on the Human Protein Atlas

Franklin M, Gentles L, Matheson E, Bown N, Cross P, Ralte A, Gilkes‐Immeson C, Bradbury A, Zanjirband M, Lunec J, Drew Y, O'Donnell R, Curtin NJ

Characterization and drug sensitivity of a novel human ovarian clear cell carcinoma cell line genomically and phenotypically similar to the original tumor

Cancer Med , 2018 Aug 14; 7(9):4744-4754. Epub 2018 Aug 14

PubMed ID: 30109783 DOI: 10.1002/cam4.1724

Yang MX, Coates RF, Ambaye A, Gardner JA, Zubarick R, Gao Y, Skelly J, Liu JG, Mino-Kenudson M

Investigation of HNF-1B as a diagnostic biomarker for pancreatic ductal adenocarcinoma

Biomark Res , 2018 Jul 27; 6:25. Epub 2018 Jul 27

PubMed ID: 30065837 DOI: 10.1186/s40364-018-0139-6

Naylor RW, Dodd RC, Davidson AJ

Caudal migration and proliferation of renal progenitors regulates early nephron segment size in zebrafish

Sci Rep , 2016 Oct 19; 6:35647. Epub 2016 Oct 19

PubMed ID: 27759103 DOI: 10.1038/srep35647

Janky R, Binda MM, Allemeersch J, Van den broeck A, Govaere O, Swinnen JV, Roskams T, Aerts S, Topal B

Prognostic relevance of molecular subtypes and master regulators in pancreatic ductal adenocarcinoma

BMC Cancer , 2016 Aug 12; 16:632. Epub 2016 Aug 12

PubMed ID: 27520560 DOI: 10.1186/s12885-016-2540-6

Omata M, Doke Y, Yamada C, Kawashima K, Sho R, Enomoto K, Furuya M, Inomata N

Hepatocyte Nuclear Factor-1β Induces Redifferentiation of Dedifferentiated Tubular Epithelial Cells

PLoS One , 2016 May 19; 11(5):e0154912. Epub 2016 May 19

PubMed ID: 27196561 DOI: 10.1371/journal.pone.0154912

Köbel M, Meng B, Hoang LN, Almadani N, Li X, Soslow RA, Gilks CB, Lee CH

Molecular analysis of mixed endometrial carcinomas shows clonality in most cases

Am J Surg Pathol , 2016 Feb; 40(2):166-180

PubMed ID: 26492180 DOI: 10.1097/PAS.0000000000000536

Diaferia GR, Balestrieri C, Prosperini E, Nicoli P, Spaggiari P, Zerbi A, Natoli G

Dissection of transcriptional and cis‐regulatory control of differentiation in human pancreatic cancer

EMBO J , 2016 Jan 14; 35(6):595-617. Epub 2016 Jan 14

PubMed ID: 26769127 DOI: 10.15252/embj.201592404

Goyeneche AA, Koch M, Bell MC, Telleria CM

Long-term primary culture of a clear cell ovarian carcinoma reveals an epithelial–mesenchymal cooperative interaction

Cancer Cell Int , 2015; 15:88. Epub 2015 Sep 24

PubMed ID: 26405433 DOI: 10.1186/s12935-015-0243-8

Davidson B

Hepatocyte nuclear factor-1β is not a specific marker of clear cell carcinoma in serous effusions.

Cancer Cytopathol , 2014 Feb; 122(2):153-8

PubMed ID: 24115587 DOI: 10.1002/cncy.21353

Donthamsetty S, Bhave VS, Mars WM, Bowen WC, Orr A, Haynes MM, Wu C, Michalopoulos GK

Role of PINCH and Its Partner Tumor Suppressor Rsu-1 in Regulating Liver Size and Tumorigenesis

PLoS One , 2013; 8(9):e74625. Epub 2013 Sep 18

PubMed ID: 24058607 DOI: 10.1371/journal.pone.0074625

Szponar A, Yusenko MV, Kuiper R, van Kessel AG, Kovacs G

Genomic profiling of papillary renal cell tumours identifies small regions of DNA alterations: a possible role of HNF1B in tumour development.

Histopathology , 2011 May; 58(6):934-43. Epub 2011 Mar 25

PubMed ID: 21438902 DOI: 10.1111/j.1365-2559.2011.03795.x

Did we miss your publication?

Have you published using HPA002083? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch