Anti-HMGCR Antibody

3-hydroxy-3-methylglutaryl-CoA reductase
Recommended Applications
Product Description
Polyclonal Antibody against Human HMGCR
Price
$445.00
Product Number
HPA008338
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target Protein
3-hydroxy-3-methylglutaryl-CoA reductase
Target Gene
HMGCR
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQG
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000016122 (99%)

Mouse ENSMUSG00000021670 (99%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Protocols
Protein Name
3-hydroxy-3-methylglutaryl-CoA reductase
Gene Name
HMGCR
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000113161 on the Human Protein Atlas

Wei S, Liu L, Chen Z, Yin W, Liu Y, Ouyang Q, Zeng F, Nie Y, Chen T

Artesunate inhibits the mevalonate pathway and promotes glioma cell senescence

J Cell Mol Med , 2019 Nov 20; 24(1):276-284. Epub 2019 Nov 20

PubMed ID: 31746143 DOI: 10.1111/jcmm.14717

Tryggvadottir H, Huzell L, Gustbée E, Simonsson M, Markkula A, Jirström K, Rose C, Ingvar C, Borgquist S, Jernström H

Interactions Between ABCB1 Genotype and Preoperative Statin Use Impact Clinical Outcomes Among Breast Cancer Patients

Front Oncol , 2018 Oct 12; 8:428. Epub 2018 Oct 12

PubMed ID: 30370250 DOI: 10.3389/fonc.2018.00428

Deng YZ, Cai Z, Shi S, Jiang H, Shang YR, Ma N, Wang JJ, Guan DX, Chen TW, Rong YF, Qian ZY, Zhang EB, Feng D, Zhou QL, Du YN, Liu DP, Huang XX, Liu LM, Chin E, Li DS, Wang XF, Zhang XL, Xie D

Cilia loss sensitizes cells to transformation by activating the mevalonate pathway

J Exp Med , 2018 Jan 2; 215(1):177-195

PubMed ID: 29237705 DOI: 10.1084/jem.20170399

Gray RT, Loughrey MB, Bankhead P, Cardwell CR, McQuaid S, O'Neill RF, Arthur K, Bingham V, McGready C, Gavin AT, James JA, Hamilton PW, Salto-Tellez M, Murray LJ, Coleman HG

Statin use, candidate mevalonate pathway biomarkers, and colon cancer survival in a population-based cohort study

Br J Cancer , 2017 May 18; 116(12):1652-1659. Epub 2017 May 18

PubMed ID: 28524155 DOI: 10.1038/bjc.2017.139

Di Benedetto A, Mottolese M, Sperati F, Ercolani C, Di Lauro L, Pizzuti L, Vici P, Terrenato I, Shaaban AM, Sundara-Rajan S, Humphries MP, Barba M, Speirs V, De Maria R, Maugeri-Saccà M

HMG-CoAR expression in male breast cancer: relationship with hormone receptors, Hippo transducers and survival outcomes

Sci Rep , 2016 Oct 7; 6:35121. Epub 2016 Oct 7

PubMed ID: 27713571 DOI: 10.1038/srep35121

Kimbung S, Lettiero B, Feldt M, Bosch A, Borgquist S

High expression of cholesterol biosynthesis genes is associated with resistance to statin treatment and inferior survival in breast cancer

Oncotarget , 2016 Jul 21; 7(37):59640-59651. Epub 2016 Jul 21

PubMed ID: 27458152 DOI: 10.18632/oncotarget.10746

Gustbée E, Tryggvadottir H, Markkula A, Simonsson M, Nodin B, Jirström K, Rose C, Ingvar C, Borgquist S, Jernström H

Tumor-specific expression of HMG-CoA reductase in a population-based cohort of breast cancer patients

BMC Clin Pathol , 2015; 15:8. Epub 2015 May 20

PubMed ID: 26109908 DOI: 10.1186/s12907-015-0008-2

Bengtsson E, Nerjovaj P, Wangefjord S, Nodin B, Eberhard J, Uhlén M, Borgquist S, Jirström K

HMG-CoA reductase expression in primary colorectal cancer correlates with favourable clinicopathological characteristics and an improved clinical outcome

Diagn Pathol , 2014 Apr 7; 9:78. Epub 2014 Apr 7

PubMed ID: 24708688 DOI: 10.1186/1746-1596-9-78

Bjarnadottir O, Romero Q, Bendahl PO, Jirström K, Rydén L, Loman N, Uhlén M, Johannesson H, Rose C, Grabau D, Borgquist S

Targeting HMG-CoA reductase with statins in a window-of-opportunity breast cancer trial.

Breast Cancer Res Treat , 2013 Apr; 138(2):499-508. Epub 2013 Mar 8

PubMed ID: 23471651 DOI: 10.1007/s10549-013-2473-6

Did we miss your publication?

Have you published using HPA008338? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch