Enhanced Validation

Polyclonal Anti-HMCES Antibody

5-hydroxymethylcytosine (hmC) binding, ES cell-specific
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human HMCES
Alternative Gene Names
C3orf37, DC12, SRAPD1
Price
$459.00
Product Number
HPA044968
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
5-hydroxymethylcytosine (hmC) binding, ES cell-specific
Target Gene
HMCES
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
WRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIHHRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNS
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000010474 (88%)

Mouse ENSMUSG00000030060 (87%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
5-hydroxymethylcytosine (hmC) binding, ES cell-specific
Gene Name
HMCES
Alternative Gene Names
C3orf37, DC12, SRAPD1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000183624 on the Human Protein Atlas

Biayna J, Garcia-Cao I, Álvarez MM, Salvadores M, Espinosa-Carrasco J, McCullough M, Supek F, Stracker TH

Loss of the abasic site sensor HMCES is synthetic lethal with the activity of the APOBEC3A cytosine deaminase in cancer cells

PLoS Biol , 2021 Mar 31; 19(3):e3001176. Epub 2021 Mar 31

PubMed ID: 33788831 DOI: 10.1371/journal.pbio.3001176

Mehta KP, Lovejoy CA, Zhao R, Heintzman DR, Cortez D

HMCES Maintains Replication Fork Progression and Prevents Double-Strand Breaks in Response to APOBEC Deamination and Abasic Site Formation

Cell Rep , 2020 Jun 2; 31(9):107705

PubMed ID: 32492421 DOI: 10.1016/j.celrep.2020.107705

Srivastava M, Su D, Zhang H, Chen Z, Tang M, Nie L, Chen J

HMCES safeguards replication from oxidative stress and ensures error‐free repair

EMBO Rep , 2020 Apr 19; 21(6):e49123. Epub 2020 Apr 19

PubMed ID: 32307824 DOI: 10.15252/embr.201949123

Mohni KN, Wessel SR, Zhao R, Wojciechowski AC, Luzwick JW, Layden H, Eichman BF, Thompson PS, Mehta KP, Cortez D

HMCES maintains genome integrity by shielding abasic sites in single strand DNA

Cell , 2018 Dec 13; 176(1-2):144-153.e13. Epub 2018 Dec 13

PubMed ID: 30554877 DOI: 10.1016/j.cell.2018.10.055

Did we miss your publication?

Have you published using HPA044968? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch