Enhanced Validation

Polyclonal Anti-HLA-DRA Antibody

major histocompatibility complex, class II, DR alpha
References (2)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human HLA-DRA
Alternative Gene Names
HLA-DRA1
Open Datasheet
Price
$505.00
Product Number
HPA053176
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[9 pictures]
Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using HPA053176 antibody. Corresponding HLA-DRA RNA-seq data are presented for the same tissues.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
major histocompatibility complex, class II, DR alpha
Target Gene
HLA-DRA
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
AIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKK
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000032844 (83%)

Mouse ENSMUSG00000024334 (41%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-HLA-DRA HPA050162.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA053176 on the Human Protein Atlas
Protein Name
major histocompatibility complex, class II, DR alpha
Gene Name
HLA-DRA
Alternative Gene Names
HLA-DRA1
UniProt ID
P01903
Gene (Ensembl)
ENSG00000204287
Entrez Gene ID
Entrez gene: 3122
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000204287 on the Human Protein Atlas

Balakrishnan CK, Tye GJ, Balasubramaniam SD, Kaur G

CD74 and HLA-DRA in Cervical Carcinogenesis: Potential Targets for Antitumour Therapy

Medicina (Kaunas) , 2022 Jan 26; 58(2):190. Epub 2022 Jan 26

PubMed ID: 35208514 DOI: 10.3390/medicina58020190

Did we miss your publication?

Have you published using HPA053176? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch