Polyclonal Anti-HJURP Antibody

Holliday junction recognition protein
References (9)
Recommended Applications
Product Description
Polyclonal Antibody against Human HJURP
Alternative Gene Names
DKFZp762E1312, FAKTS, hFLEG1, URLC9
Open Datasheet
Price
$505.00
Product Number
HPA008436
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[4 pictures]
Immunohistochemical staining of human lymph node shows moderate to strong nuclear positivity in lymphoid cells.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line A-431 shows positivity in nucleus & nucleoli.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
Holliday junction recognition protein
Target Gene
HJURP
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TPVVQMATLTYETPQGLRIWGGRLIKERNEGEIQDSSMKPADRTDGSVQAAAWGPELPSHRTVLGADSKSGEVDATSDQEESVAWALAPAVPQSPLKNELRRKYLTQVDILLQGAEYFECAGNRAGRDVRV
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000022911 (43%)

Mouse ENSMUSG00000044783 (37%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Protein Name
Holliday junction recognition protein
Gene Name
HJURP
Alternative Gene Names
DKFZp762E1312, FAKTS, hFLEG1, URLC9
UniProt ID
Q8NCD3
Gene (Ensembl)
ENSG00000123485
Entrez Gene ID
Entrez gene: 55355
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000123485 on the Human Protein Atlas

Hammond CM, Bao H, Hendriks IA, Carraro M, García-Nieto A, Liu Y, Reverón-Gómez N, Spanos C, Chen L, Rappsilber J, Nielsen ML, Patel DJ, Huang H, Groth A

DNAJC9 integrates heat shock molecular chaperones into the histone chaperone network

Mol Cell , 2021 Jun 17; 81(12):2533-2548.e9

PubMed ID: 33857403 DOI: 10.1016/j.molcel.2021.03.041

Jeffery D, Gatto A, Podsypanina K, Renaud-Pageot C, Ponce Landete R, Bonneville L, Dumont M, Fachinetti D, Almouzni G

CENP-A overexpression promotes distinct fates in human cells, depending on p53 status

Commun Biol , 2021 Mar 26; 4:417. Epub 2021 Mar 26

PubMed ID: 33772115 DOI: 10.1038/s42003-021-01941-5

Nye J, Sturgill D, Athwal R, Dalal Y

HJURP antagonizes CENP-A mislocalization driven by the H3.3 chaperones HIRA and DAXX

PLoS One , 2018 Oct 26; 13(10):e0205948. Epub 2018 Oct 26

PubMed ID: 30365520 DOI: 10.1371/journal.pone.0205948

Filipescu D, Naughtin M, Podsypanina K, Lejour V, Wilson L, Gurard-Levin ZA, Orsi GA, Simeonova I, Toufektchan E, Attardi LD, Toledo F, Almouzni G

Essential role for centromeric factors following p53 loss and oncogenic transformation

Genes Dev , 2017 Mar 1; 31(5):463-480

PubMed ID: 28356341 DOI: 10.1101/gad.290924.116

Huang W, Zhang H, Hao Y, Xu X, Zhai Y, Wang S, Li Y, Ma F, Li Y, Wang Z, Zhang Y, Zhang X, Liang R, Wei Z, Cui Y, Li Y, Yu X, Ji H, He F, Xie W, Zhou G

A Non-Synonymous Single Nucleotide Polymorphism in the HJURP Gene Associated with Susceptibility to Hepatocellular Carcinoma among Chinese

PLoS One , 2016 Feb; 11(2):e0148618. Epub 2016 Feb 10

PubMed ID: 26863619 DOI: 10.1371/journal.pone.0148618

de Tayrac M, Saikali S, Aubry M, Bellaud P, Boniface R, Quillien V, Mosser J

Prognostic Significance of EDN/RB, HJURP, p60/CAF-1 and PDLI4, Four New Markers in High-Grade Gliomas

PLoS One , 2013; 8(9):e73332. Epub 2013 Sep 11

PubMed ID: 24039914 DOI: 10.1371/journal.pone.0073332

Hu Z, Huang G, Sadanandam A, Gu S, Lenburg ME, Pai M, Bayani N, Blakely EA, Gray JW, Mao JH

The expression level of HJURP has an independent prognostic impact and predicts the sensitivity to radiotherapy in breast cancer

Breast Cancer Res , 2010; 12(2):R18. Epub 2010 Mar 8

PubMed ID: 20211017 DOI: 10.1186/bcr2487

Shuaib M, Ouararhni K, Dimitrov S, Hamiche A

HJURP binds CENP-A via a highly conserved N-terminal domain and mediates its deposition at centromeres.

Proc Natl Acad Sci U S A , 2010 Jan 26; 107(4):1349-54. Epub 2010 Jan 6

PubMed ID: 20080577 DOI: 10.1073/pnas.0913709107

Did we miss your publication?

Have you published using HPA008436? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-HJURP (HPA027261)
Corresponding Antigens
PrEST Antigen HJURP (APrEST71334)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch