Enhanced Validation

Anti-GRIA2 Antibody

glutamate receptor, ionotropic, AMPA 2
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human GRIA2
Alternative Gene Names
GluA2, GLUR2, GLURB
Price
$445.00
Product Number
HPA008441
Unit Size
Concentration
Lot dependent
Availability
On Demand
Ships
On Demand
Target Protein
glutamate receptor, ionotropic, AMPA 2
Target Gene
GRIA2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
NLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000033981 (100%)

Rat ENSRNOG00000054204 (99%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
glutamate receptor, ionotropic, AMPA 2
Gene Name
GRIA2
Alternative Gene Names
GluA2, GLUR2, GLURB
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000120251 on the Human Protein Atlas

Choi CH, Choi JJ, Park YA, Lee YY, Song SY, Sung CO, Song T, Kim MK, Kim TJ, Lee JW, Kim HJ, Bae DS, Kim BG

Identification of differentially expressed genes according to chemosensitivity in advanced ovarian serous adenocarcinomas: expression of GRIA2 predicts better survival

Br J Cancer , 2012 Jun 26; 107(1):91-99. Epub 2012 May 29

PubMed ID: 22644307 DOI: 10.1038/bjc.2012.217

Leja J, Essaghir A, Essand M, Wester K, Oberg K, Tötterman TH, Lloyd R, Vasmatzis G, Demoulin JB, Giandomenico V

Novel markers for enterochromaffin cells and gastrointestinal neuroendocrine carcinomas.

Mod Pathol , 2009 Feb; 22(2):261-72. Epub 2008 Oct 24

PubMed ID: 18953328 DOI: 10.1038/modpathol.2008.174

Did we miss your publication?

Have you published using HPA008441? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch