Enhanced Validation

Anti-GDF15 Antibody

growth differentiation factor 15
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human GDF15
Alternative Gene Names
MIC-1, MIC1, NAG-1, PDF, PLAB, PTGFB
Price
$437.00
Product Number
HPA011191
Unit Size
100 µl
Concentration
Lot dependent
Availability
On Demand
Ships
On Demand
Target protein
growth differentiation factor 15
Target gene
GDF15
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQL
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000038508 (53%)

Rat ENSRNOG00000019661 (51%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
growth differentiation factor 15
Gene Name
GDF15
Alternative Gene Names
MIC-1, MIC1, NAG-1, PDF, PLAB, PTGFB
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000130513 on the Human Protein Atlas

Ishige T, Nishimura M, Satoh M, Fujimoto M, Fukuyo M, Semba T, Kado S, Tsuchida S, Sawai S, Matsushita K, Togawa A, Matsubara H, Kaneda A, Nomura F

Combined Secretomics and Transcriptomics Revealed Cancer-Derived GDF15 is Involved in Diffuse-Type Gastric Cancer Progression and Fibroblast Activation

Sci Rep , 2016 Feb 19; 6:21681. Epub 2016 Feb 19

PubMed ID: 26892343 DOI: 10.1038/srep21681

Uchiyama T, Kawabata H, Miura Y, Yoshioka S, Iwasa M, Yao H, Sakamoto S, Fujimoto M, Haga H, Kadowaki N, Maekawa T, Takaori-Kondo A

The role of growth differentiation factor 15 in the pathogenesis of primary myelofibrosis

Cancer Med , 2015 Oct; 4(10):1558-1572. Epub 2015 Aug 15

PubMed ID: 26276681 DOI: 10.1002/cam4.502

Liu X, Chi X, Gong Q, Gao L, Niu Y, Chi X, Cheng M, Si Y, Wang M, Zhong J, Niu J, Yang W

Association of Serum Level of Growth Differentiation Factor 15 with Liver Cirrhosis and Hepatocellular Carcinoma

PLoS One , 2015; 10(5):e0127518. Epub 2015 May 21

PubMed ID: 25996938 DOI: 10.1371/journal.pone.0127518

Lee J, Fricke F, Warnken U, Schnölzer M, Kopitz J, Gebert J

Reconstitution of TGFBR2-Mediated Signaling Causes Upregulation of GDF-15 in HCT116 Colorectal Cancer Cells

PLoS One , 2015; 10(6):e0131506. Epub 2015 Jun 26

PubMed ID: 26114631 DOI: 10.1371/journal.pone.0131506

Naoki Urakawa, Soken Utsunomiya, Mari Nishio, Manabu Shigeoka, Nobuhisa Takase, Noriaki Arai, Yoshihiro Kakeji, Yu-ichiro Koma, Hiroshi Yokozaki

GDF15 derived from both tumor-associated macrophages and esophageal squamous cell carcinomas contributes to tumor progression via Akt and Erk pathways

Laboratory Investigation , March 02, 2015

PubMed ID: 0 DOI: 10.1038/labinvest.2015.36

Nickel N, Jonigk D, Kempf T, Bockmeyer CL, Maegel L, Rische J, Laenger F, Lehmann U, Sauer C, Greer M, Welte T, Hoeper MM, Golpon HA

GDF-15 is abundantly expressed in plexiform lesions in patients with pulmonary arterial hypertension and affects proliferation and apoptosis of pulmonary endothelial cells

Respir Res , 2011 May 6; 12(1):62. Epub 2011 May 6

PubMed ID: 21548946 DOI: 10.1186/1465-9921-12-62

Wallin U, Glimelius B, Jirström K, Darmanis S, Nong RY, Pontén F, Johansson C, Påhlman L, Birgisson H

Growth differentiation factor 15: a prognostic marker for recurrence in colorectal cancer

Br J Cancer , 2011 May 10; 104(10):1619-1627. Epub 2011 Apr 5

PubMed ID: 21468045 DOI: 10.1038/bjc.2011.112

Roth P, Junker M, Tritschler I, Mittelbronn M, Dombrowski Y, Breit SN, Tabatabai G, Wick W, Weller M, Wischhusen J

GDF-15 contributes to proliferation and immune escape of malignant gliomas.

Clin Cancer Res , 2010 Aug 1; 16(15):3851-9. Epub 2010 Jun 9

PubMed ID: 20534737 DOI: 10.1158/1078-0432.CCR-10-0705

Tabrizi AD, Kalloger SE, Köbel M, Cipollone J, Roskelley CD, Mehl E, Gilks CB

Primary ovarian mucinous carcinoma of intestinal type: significance of pattern of invasion and immunohistochemical expression profile in a series of 31 cases.

Int J Gynecol Pathol , 2010 Mar; 29(2):99-107

PubMed ID: 20173494 DOI: 10.1097/PGP.0b013e3181bbbcc1

Did we miss your publication?

Have you published using HPA011191? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more