Enhanced Validation

Anti-GAPDH Antibody

glyceraldehyde-3-phosphate dehydrogenase
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human GAPDH
Alternative Gene Names
GAPD
Price
$437.00
Product Number
HPA040067
Unit Size
100 µl
Concentration
Lot dependent
Availability
5 in Stock
Ships
Ready to Ship
Target protein
glyceraldehyde-3-phosphate dehydrogenase
Target gene
GAPDH
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIIS
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000030963 (94%)

Mouse ENSMUSG00000110469 (92%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Protein Name
glyceraldehyde-3-phosphate dehydrogenase
Gene Name
GAPDH
Alternative Gene Names
GAPD
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000111640 on the Human Protein Atlas

Li WD, Xia JR, Lian YS

Hepatic miR-215 target Rictor and modulation of hepatic insulin signalling in rats

Mol Med Rep , 2019 Mar 14; 19(5):3723-3731. Epub 2019 Mar 14

PubMed ID: 30896868 DOI: 10.3892/mmr.2019.10031

Shao J, Miao C, Geng Z, Gu M, Wu Y, Li Q

Effect of eNOS on Ischemic Postconditioning-Induced Autophagy against Ischemia/Reperfusion Injury in Mice

Biomed Res Int , 2019 Feb 10; 2019:5201014. Epub 2019 Feb 10

PubMed ID: 30881990 DOI: 10.1155/2019/5201014

Lu H, Lei X, Zhang Q

Moderate activation of IKK2-NF-kB in unstressed adult mouse liver induces cytoprotective genes and lipogenesis without apparent signs of inflammation or fibrosis

BMC Gastroenterol , 2015 Jul 30; 15:94. Epub 2015 Jul 30

PubMed ID: 26219821 DOI: 10.1186/s12876-015-0325-z

Desmurs M, Foti M, Raemy E, Vaz FM, Martinou JC, Bairoch A, Lane L

C11orf83, a Mitochondrial Cardiolipin-Binding Protein Involved in bc1 Complex Assembly and Supercomplex Stabilization

Mol Cell Biol , 2015 Apr; 35(7):1139-1156. Epub 2015 Mar 10

PubMed ID: 25605331 DOI: 10.1128/MCB.01047-14

Did we miss your publication?

Have you published using HPA040067? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch