Enhanced Validation

Anti-GAP43 Antibody

growth associated protein 43
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human GAP43
Alternative Gene Names
B-50, PP46
Price
$445.00
Product Number
HPA015600
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
growth associated protein 43
Target Gene
GAP43
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000047261 (71%)

Rat ENSRNOG00000001528 (70%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
growth associated protein 43
Gene Name
GAP43
Alternative Gene Names
B-50, PP46
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000172020 on the Human Protein Atlas

Wu D, Lee S, Gushchina S, Richardson PM, Yeh J, Krügel U, Franke H, Zhang Y, Bo X

Intraneural Injection of ATP Stimulates Regeneration of Primary Sensory Axons in the Spinal Cord

J Neurosci , 2018 Feb 7; 38(6):1351-1365

PubMed ID: 29279307 DOI: 10.1523/JNEUROSCI.1660-17.2017

Remnestål J, Just D, Mitsios N, Fredolini C, Mulder J, Schwenk JM, Uhlén M, Kultima K, Ingelsson M, Kilander L, Lannfelt L, Svenningsson P, Nellgård B, Zetterberg H, Blennow K, Nilsson P, Häggmark‐Månberg A

CSF profiling of the human brain enriched proteome reveals associations of neuromodulin and neurogranin to Alzheimer's disease

Proteomics Clin Appl , 2016 Oct 10; 10(12):1242-1253. Epub 2016 Oct 10

PubMed ID: 27604409 DOI: 10.1002/prca.201500150

Phatak NR, Stankowska DL, Krishnamoorthy RR

Transcription factor Brn-3b overexpression enhances neurite outgrowth in PC12 cells under condition of hypoxia

Cell Mol Neurobiol , 2015 Mar 19; 35(6):769-783. Epub 2015 Mar 19

PubMed ID: 25786379 DOI: 10.1007/s10571-015-0171-0

Häggmark A, Byström S, Ayoglu B, Qundos U, Uhlén M, Khademi M, Olsson T, Schwenk JM, Nilsson P

Antibody-based profiling of cerebrospinal fluid within multiple sclerosis.

Proteomics , 2013 Aug; 13(15):2256-67. Epub 2013 Jun 25

PubMed ID: 23696371 DOI: 10.1002/pmic.201200580

Did we miss your publication?

Have you published using HPA015600? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch