Polyclonal Anti-FOXR2 Antibody

forkhead box R2
References (2)
Recommended Applications
Product Description
Polyclonal Antibody against Human FOXR2
Alternative Gene Names
FOXN6, MGC21658
Open Datasheet
Price
$505.00
Product Number
HPA034487
Unit Size
Concentration
Lot dependent
Availability
7 in Stock
Ships
Ready to Ship
Show all images
[1 pictures]
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in a subset of cells in exocrine pancreas.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoplasm.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
forkhead box R2
Target Gene
FOXR2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VDPNILCPLGSQEAPKPSGKEDLTNISPFPQPPQKDEGSNCSEDKVVESLPSSSSEQSPLQKQGIHS
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000071665 (36%)

Rat ENSRNOG00000030619 (34%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Protein Name
forkhead box R2
Gene Name
FOXR2
Alternative Gene Names
FOXN6, MGC21658
UniProt ID
Q6PJQ5
Gene (Ensembl)
ENSG00000189299
Entrez Gene ID
Entrez gene: 139628
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000189299 on the Human Protein Atlas

Rahrmann EP, Watson AL, Keng VW, Choi K, Moriarity BS, Beckmann DA, Wolf NK, Sarver A, Collins MH, Moertel CL, Wallace MR, Gel B, Serra E, Ratner N, Largaespada DA

Forward genetic screen for malignant peripheral nerve sheath tumor formation identifies new genes and pathways driving tumorigenesis.

Nat Genet , 2013 Jul; 45(7):756-66. Epub 2013 May 19

PubMed ID: 23685747 DOI: 10.1038/ng.2641

Did we miss your publication?

Have you published using HPA034487? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-FOXR2 (HPA057358)
Corresponding Antigens
PrEST Antigen FOXR2 (APrEST78318)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch