Anti-FOXP2 Antibody

forkhead box P2
Recommended Applications
Product Description
Polyclonal Antibody against Human FOXP2
Alternative Gene Names
CAGH44, SPCH1, TNRC10
Price
$445.00
Product Number
HPA000382
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
forkhead box P2
Target Gene
FOXP2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
AQQLVFQQQLLQMQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSSTTSSNTSKASPPITHHS
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000029563 (99%)

Rat ENSRNOG00000054508 (97%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
forkhead box P2
Gene Name
FOXP2
Alternative Gene Names
CAGH44, SPCH1, TNRC10
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000128573 on the Human Protein Atlas

Klug JR, Engelhardt MD, Cadman CN, Li H, Smith JB, Ayala S, Williams EW, Hoffman H, Jin X

Differential inputs to striatal cholinergic and parvalbumin interneurons imply functional distinctions

eLife , 2018 May 1; 7:e35657. Epub 2018 May 1

PubMed ID: 29714166 DOI: 10.7554/eLife.35657

Shi Z, Piccus Z, Zhang X, Yang H, Jarrell H, Ding Y, Teng Z, Tchernichovski O, Li X

miR-9 regulates basal ganglia-dependent developmental vocal learning and adult vocal performance in songbirds

eLife , 2018 Jan 18; 7:e29087. Epub 2018 Jan 18

PubMed ID: 29345619 DOI: 10.7554/eLife.29087

Matsumoto N, Shinmyo Y, Ichikawa Y, Kawasaki H

Gyrification of the cerebral cortex requires FGF signaling in the mammalian brain

eLife , 2017 Nov 14; 6:e29285. Epub 2017 Nov 14

PubMed ID: 29132503 DOI: 10.7554/eLife.29285

Wallace ML, Saunders A, Huang KW, Philson AC, Goldman M, Macosko EZ, McCarroll SA, Sabatini BL

Genetically distinct parallel pathways in the entopeduncular nucleus for limbic and sensorimotor output of the basal ganglia

Neuron , 2017 Apr 5; 94(1):138-152.e5

PubMed ID: 28384468 DOI: 10.1016/j.neuron.2017.03.017

Toda T, Shinmyo Y, Dinh Duong TA, Masuda K, Kawasaki H

An essential role of SVZ progenitors in cortical folding in gyrencephalic mammals

Sci Rep , 2016 Jul 12; 6:29578. Epub 2016 Jul 12

PubMed ID: 27403992 DOI: 10.1038/srep29578

Zuko A, Oguro-Ando A, van Dijk R, Gregorio-Jordan S, van der Zwaag B, Burbach JP

Developmental role of the cell adhesion molecule Contactin-6 in the cerebral cortex and hippocampus

Cell Adh Migr , 2016 Mar 3; 10(4):378-392. Epub 2016 Mar 3

PubMed ID: 26939565 DOI: 10.1080/19336918.2016.1155018

Brunjes PC, Osterberg SK

Developmental Markers Expressed in Neocortical Layers Are Differentially Exhibited in Olfactory Cortex

PLoS One , 2015; 10(9):e0138541. Epub 2015 Sep 25

PubMed ID: 26407299 DOI: 10.1371/journal.pone.0138541

Hernández VM, Hegeman DJ, Cui Q, Kelver DA, Fiske MP, Glajch KE, Pitt JE, Huang TY, Justice NJ, Chan CS

Parvalbumin+ Neurons and Npas1+ Neurons Are Distinct Neuron Classes in the Mouse External Globus Pallidus

J Neurosci , 2015/08/26; 35(34):11830-11847

PubMed ID: 26311767 DOI: 10.1523/JNEUROSCI.4672-14.2015

Abdi A, Mallet N, Mohamed FY, Sharott A, Dodson PD, Nakamura KC, Suri S, Avery SV, Larvin JT, Garas FN, Garas SN, Vinciati F, Morin S, Bezard E, Baufreton J, Magill PJ

Prototypic and Arkypallidal Neurons in the Dopamine-Intact External Globus Pallidus

J Neurosci , 2015 Apr 29; 35(17):6667-6688

PubMed ID: 25926446 DOI: 10.1523/JNEUROSCI.4662-14.2015

Reimers-Kipping S, Hevers W, Pääbo S, Enard W

Humanized Foxp2 specifically affects cortico-basal ganglia circuits.

Neuroscience , 2011 Feb 23; 175:75-84. Epub 2010 Nov 25

PubMed ID: 21111790 DOI: 10.1016/j.neuroscience.2010.11.042

Enard W, Gehre S, Hammerschmidt K, Hölter SM, Blass T, Somel M, Brückner MK, Schreiweis C, Winter C, Sohr R, Becker L, Wiebe V, Nickel B, Giger T, Müller U, Groszer M, Adler T, Aguilar A, Bolle I, Calzada-Wack J, Dalke C, Ehrhardt N, Favor J, Fuchs H, Gailus-Durner V, Hans W, Hölzlwimmer G, Javaheri A, Kalaydjiev S, Kallnik M, Kling E, Kunder S, Mossbrugger I, Naton B, Racz I, Rathkolb B, Rozman J, Schrewe A, Busch DH, Graw J, Ivandic B, Klingenspor M, Klopstock T, Ollert M, Quintanilla-Martinez L, Schulz H, Wolf E, Wurst W, Zimmer A, Fisher SE, Morgenstern R, Arendt T, de Angelis MH, Fischer J, Schwarz J, Pääbo S

A humanized version of Foxp2 affects cortico-basal ganglia circuits in mice.

Cell , 2009 May 29; 137(5):961-71

PubMed ID: 19490899 DOI: 10.1016/j.cell.2009.03.041

Did we miss your publication?

Have you published using HPA000382? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch