Enhanced Validation

Anti-FOXJ1 Antibody

forkhead box J1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human FOXJ1
Alternative Gene Names
FKHL13, HFH-4, HFH4
Price
$445.00
Product Number
HPA005714
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
forkhead box J1
Target Gene
FOXJ1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKG
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000034227 (91%)

Rat ENSRNOG00000036663 (29%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
forkhead box J1
Gene Name
FOXJ1
Alternative Gene Names
FKHL13, HFH-4, HFH4
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000129654 on the Human Protein Atlas

Peng Y, Guan WJ, Tan KS, Zhu Z, Chen Z, Hong H, Wang Z, Tian T, Zi X, Ong YK, Thong M, Shi L, Yang Q, Qiu Q, Wang DY

Aberrant localization of FOXJ1 correlates with the disease severity and comorbidities in patients with nasal polyps

Allergy Asthma Clin Immunol , 2018 Nov 14; 14:71. Epub 2018 Nov 14

PubMed ID: 30459817 DOI: 10.1186/s13223-018-0296-z

Plasschaert LW, Žilionis R, Choo-Wing R, Savova V, Knehr J, Roma G, Klein AM, Jaffe AB

A single cell atlas of the tracheal epithelium reveals the CFTR-rich pulmonary ionocyte

Nature , 2018 Aug 1; 560(7718):377-381. Epub 2018 Aug 1

PubMed ID: 30069046 DOI: 10.1038/s41586-018-0394-6

Wang Z, Plasschaert LW, Aryal S, Renaud NA, Yang Z, Choo-Wing R, Pessotti AD, Kirkpatrick ND, Cochran NR, Carbone W, Maher R, Lindeman A, Russ C, Reece-Hoyes J, McAllister G, Hoffman GR, Roma G, Jaffe AB

TRRAP is a central regulator of human multiciliated cell formation

J Cell Biol , 2018 Jun 4; 217(6):1941-1955

PubMed ID: 29588376 DOI: 10.1083/jcb.201706106

Coy S, Du Z, Sheu SH, Woo T, Rodriguez FJ, Kieran MW, Santagata S

Distinct Patterns of Primary and Motile Cilia in Rathke’s Cleft Cysts and Craniopharyngioma Subtypes

Mod Pathol , 2016 Aug 26; 29(12):1446-1459. Epub 2016 Aug 26

PubMed ID: 27562488 DOI: 10.1038/modpathol.2016.153

Abedalthagafi MS, Wu MP, Merrill PH, Du Z, Woo T, Sheu SH, Hurwitz S, Ligon KL, Santagata S

Decreased FOXJ1 expression and its ciliogenesis program in aggressive ependymoma and choroid plexus tumours

J Pathol , 2016 Mar; 238(4):584-597

PubMed ID: 26690880 DOI: 10.1002/path.4682

Song R, Walentek P, Sponer N, Klimke A, Lee JS, Dixon G, Harland R, Wan Y, Lishko P, Lize M, Kessel M, He L

miR-34/449 miRNAs are required for motile ciliogenesis by repressing cp110

Nature , 2014 Jun 5; 510(7503):115-120

PubMed ID: 24899310 DOI: 10.1038/nature13413

Did we miss your publication?

Have you published using HPA005714? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch