Enhanced Validation

Anti-FMNL2 Antibody

formin-like 2
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human FMNL2
Alternative Gene Names
FHOD2, KIAA1902
Price
$445.00
Product Number
HPA005464
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
formin-like 2
Target Gene
FMNL2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ERVEELEENISHLSEKLQDTENEAMSKIVELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEKQGTIKIQKKGDGDIAILPVVASGTLSMGSEVVAGNSVGP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000055567 (95%)

Mouse ENSMUSG00000036053 (94%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
formin-like 2
Gene Name
FMNL2
Alternative Gene Names
FHOD2, KIAA1902
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000157827 on the Human Protein Atlas

Grobe H, Wüstenhagen A, Baarlink C, Grosse R, Grikscheit K

A Rac1-FMNL2 signaling module affects cell-cell contact formation independent of Cdc42 and membrane protrusions

PLoS One , 2018 Mar 26; 13(3):e0194716. Epub 2018 Mar 26

PubMed ID: 29579104 DOI: 10.1371/journal.pone.0194716

Grikscheit K, Frank T, Wang Y, Grosse R

Junctional actin assembly is mediated by Formin-like 2 downstream of Rac1

J Cell Biol , 2015 May 11; 209(3):367-376

PubMed ID: 25963818 DOI: 10.1083/jcb.201412015

Gardberg M, Talvinen K, Kaipio K, Iljin K, Kampf C, Uhlen M, Carpén O

Characterization of Diaphanous-related formin FMNL2 in human tissues.

BMC Cell Biol , 2010 Jul 15; 11:55. Epub 2010 Jul 15

PubMed ID: 20633255 DOI: 10.1186/1471-2121-11-55

Did we miss your publication?

Have you published using HPA005464? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch