Enhanced Validation

Anti-FLNC Antibody

filamin C, gamma
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human FLNC
Alternative Gene Names
ABP-280, ABPL, FLN2
Price
$445.00
Product Number
HPA006135
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
filamin C, gamma
Target Gene
FLNC
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
HSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDY
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000068699 (99%)

Rat ENSRNOG00000007281 (99%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
filamin C, gamma
Gene Name
FLNC
Alternative Gene Names
ABP-280, ABPL, FLN2
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000128591 on the Human Protein Atlas

Tucker NR, McLellan MA, Hu D, Ye J, Parsons VA, Mills RW, Clauss S, Dolmatova E, Shea MA, Milan DJ, Scott NS, Lindsay M, Lubitz SA, Domian IJ, Stone JR, Lin H, Ellinor PT

Novel Mutation in FLNC (Filamin C) Causes Familial Restrictive Cardiomyopathy

Circ Cardiovasc Genet , 2017 Dec; 10(6):e001780

PubMed ID: 29212899 DOI: 10.1161/CIRCGENETICS.117.001780

Papizan JB, Garry GA, Brezprozvannaya S, McAnally JR, Bassel-Duby R, Liu N, Olson EN

Deficiency in Kelch protein Klhl31 causes congenital myopathy in mice

J Clin Invest , 2017 Sep 5; 127(10):3730-3740. Epub 2017 Sep 5

PubMed ID: 28872460 DOI: 10.1172/JCI93445

Djuric U, Rodrigues DC, Batruch I, Ellis J, Shannon P, Diamandis P

Spatiotemporal Proteomic Profiling of Human Cerebral Development

Mol Cell Proteomics , 2017 Jul 7; 16(9):1548-1562. Epub 2017 Jul 7

PubMed ID: 28687556 DOI: 10.1074/mcp.M116.066274

Begay RL, Tharp CA, Martin A, Graw SL, Sinagra G, Miani D, Sweet ME, Slavov DB, Stafford N, Zeller MJ, Alnefaie R, Rowland TJ, Brun F, Jones KL, Gowan K, Mestroni L, Garrity DM, Taylor MR

FLNC Gene Splice Mutations Cause Dilated Cardiomyopathy

JACC Basic Transl Sci , 2016 Jul 27; 1(5):344-359. Epub 2016 Jul 27

PubMed ID: 28008423 DOI: 10.1016/j.jacbts.2016.05.004

Did we miss your publication?

Have you published using HPA006135? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch