Enhanced Validation

Anti-FIS1 Antibody

fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
Recommended Applications
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human FIS1
Alternative Gene Names
CGI-135, Fis1, H_NH0132A01.6, TTC11
Price
$437.00
Product Number
HPA017430
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
Target gene
FIS1
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000001420 (96%)

Mouse ENSMUSG00000019054 (95%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Protein Name
fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
Gene Name
FIS1
Alternative Gene Names
CGI-135, Fis1, H_NH0132A01.6, TTC11
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000214253 on the Human Protein Atlas

Lobet E, Willemart K, Ninane N, Demazy C, Sedzicki J, Lelubre C, De Bolle X, Renard P, Raes M, Dehio C, Letesson JJ, Arnould T

Mitochondrial fragmentation affects neither the sensitivity to TNFα-induced apoptosis of Brucella-infected cells nor the intracellular replication of the bacteria

Sci Rep , 2018 Mar 26; 8:5173. Epub 2018 Mar 26

PubMed ID: 29581535 DOI: 10.1038/s41598-018-23483-3

O’Rourke AR, Lindsay A, Tarpey MD, Yuen S, McCourt P, Nelson DM, Perrin BJ, Thomas DD, Spangenburg EE, Lowe DA, Ervasti JM

Impaired muscle relaxation and mitochondrial fission associated with genetic ablation of cytoplasmic actin isoforms

FEBS J , 2018 Jan 8; 285(3):481-500. Epub 2018 Jan 8

PubMed ID: 29265728 DOI: 10.1111/febs.14367

Stocks B, Dent JR, Joanisse S, McCurdy CE, Philp A

Skeletal Muscle Fibre-Specific Knockout of p53 Does Not Reduce Mitochondrial Content or Enzyme Activity

Front Physiol , 2017 Dec 4; 8:941. Epub 2017 Dec 4

PubMed ID: 29255419 DOI: 10.3389/fphys.2017.00941

Lauritzen KH, Hasan-Olive MM, Regnell CE, Kleppa L, Scheibye-Knudsen M, Gjedde A, Klungland A, Bohr VA, Storm-Mathisen J, Bergersen LH

A ketogenic diet accelerates neurodegeneration in mice with induced mitochondrial DNA toxicity in the forebrain

Neurobiol Aging , 2016 Aug 18; 48:34-47. Epub 2016 Aug 18

PubMed ID: 27639119 DOI: 10.1016/j.neurobiolaging.2016.08.005

Van Beersel G, Tihon E, Demine S, Hamer I, Jadot M, Arnould T

Different molecular mechanisms involved in spontaneous and oxidative stress-induced mitochondrial fragmentation in tripeptidyl peptidase-1 (TPP-1)-deficient fibroblasts

Biosci Rep , 2013 Feb 7; 33(2):e00023. Epub 2013 Feb 7

PubMed ID: 23249249 DOI: 10.1042/BSR20120104

Did we miss your publication?

Have you published using HPA017430? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens