Anti-FGFR4 Antibody

fibroblast growth factor receptor 4
Recommended Applications
Product Description
Polyclonal Antibody against Human FGFR4
Alternative Gene Names
CD334, JTK2
Price
$445.00
Product Number
HPA028251
Unit Size
100 µl
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
fibroblast growth factor receptor 4
Target Gene
FGFR4
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
EEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000005320 (90%)

Rat ENSRNOG00000016763 (87%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Protocols
Protein Name
fibroblast growth factor receptor 4
Gene Name
FGFR4
Alternative Gene Names
CD334, JTK2
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000160867 on the Human Protein Atlas

Soady KJ, Tornillo G, Kendrick H, Meniel V, Olijnyk-Dallis D, Morris JS, Stein T, Gusterson BA, Isacke CM, Smalley MJ

Receptor protein tyrosine phosphatase PTPRB negatively regulates FGF2-dependent branching morphogenesis

Development , 2017 Sep 4; 144(20):3777-3788. Epub 2017 Sep 4

PubMed ID: 28870991 DOI: 10.1242/dev.149120

Did we miss your publication?

Have you published using HPA028251? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch