Anti-FERMT2 Antibody

fermitin family member 2
Recommended Applications
Product Description
Polyclonal Antibody against Human FERMT2
Alternative Gene Names
KIND2, mig-2, PLEKHC1, UNC112B
Price
$445.00
Product Number
HPA040505
Unit Size
100 µl
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
fermitin family member 2
Target Gene
FERMT2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQITARILEA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000009102 (97%)

Mouse ENSMUSG00000037712 (94%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
fermitin family member 2
Gene Name
FERMT2
Alternative Gene Names
KIND2, mig-2, PLEKHC1, UNC112B
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000073712 on the Human Protein Atlas

Chiea Chuen Khor, Tan Do, Hongyan Jia, Masakazu Nakano, Ronnie George, Khaled Abu-Amero, Roopam Duvesh, Li Jia Chen, Zheng Li, Monisha E Nongpiur, Shamira A Perera, Chunyan Qiao, Hon-Tym Wong, Hiroshi Sakai, Mônica Barbosa de Melo, Mei-Chin Lee, Anita S Chan, Yaakub Azhany, Thi Lam Huong Dao, Yoko Ikeda, Rodolfo A Perez-Grossmann, Tomasz Zarnowski, Alexander C Day, Jost B Jonas, Pancy O S Tam, Tuan Anh Tran, Humaira Ayub, Farah Akhtar, Shazia Micheal, Paul T K Chew, Leyla A Aljasim, Tanuj Dada, Tam Thi Luu, Mona S Awadalla, Naris Kitnarong, Boonsong Wanichwecharungruang, Yee Yee Aung, Jelinar Mohamed-Noor, Saravanan Vijayan, Sripriya Sarangapani, Rahat Husain, Aliza Jap, Mani Baskaran, David Goh, Daniel H Su, Huaizhou Wang, Vernon K Yong, Leonard W Yip, Tuyet Bach Trinh, Manchima Makornwattana, Thanh Thu Nguyen, Edgar U Leuenberger, Ki-Ho Park, Widya Artini Wiyogo, Rajesh S Kumar, Celso Tello, Yasuo Kurimoto, Suman S Thapa, Kessara Pathanapitoon, John F Salmon, Yong Ho Sohn, Antonio Fea, Mineo Ozaki, Jimmy S M Lai, Visanee Tantisevi, Chaw Chaw Khaing, Takanori Mizoguchi, Satoko Nakano, Chan-Yun Kim, Guangxian Tang, Sujie Fan, Renyi Wu, Hailin Meng, Thi Thuy Giang Nguyen, Tien Dat Tran, Morio Ueno, Jose Maria Martinez, Norlina Ramli, Yin Mon Aung, Rigo Daniel Reyes, Stephen A Vernon, Seng Kheong Fang, Zhicheng Xie, Xiao Yin Chen, Jia Nee Foo, Kar Seng Sim, Tina T Wong, Desmond T Quek, Rengaraj Venkatesh, Srinivasan Kavitha, Subbiah R Krishnadas, Nagaswamy Soumittra, Balekudaru Shantha, Boon-Ang Lim, Jeanne Ogle, José P C de Vasconcellos, Vital P Costa, Ricardo Y Abe, Bruno B de Souza, Chelvin C Sng, Maria C Aquino, Ewa Kosior-Jarecka, Guillermo Barreto Fong, Vania Castro Tamanaja, Ricardo Fujita, Yuzhen Jiang, Naushin Waseem, Sancy Low, Huan Nguyen Pham, Sami Al-Shahwan, E Randy Craven, Muhammad Imran Khan, Rrima Dada, Kuldeep Mohanty, Muneeb A Faiq, Alex W Hewitt, Kathryn P Burdon, Eng Hui Gan, Anuwat Prutthipongsit, Thipnapa Patthanathamrongkasem, Mary Ann T Catacutan, Irene R Felarca, Chona S Liao, Emma Rusmayani, Vira Wardhana Istiantoro, Giulia Consolandi, Giulia Pignata, Carlo Lavia, Prin Rojanapongpun, Lerprat Mangkornkanokpong, Sunee Chansangpetch, Jonathan C H Chan, Bonnie N K Choy, Jennifer W H Shum, Hlaing May Than, Khin Thida Oo, Aye Thi Han, Victor H Yong, Xiao-Yu Ng, Shuang Ru Goh, Yaan Fun Chong, Martin L Hibberd, Mark Seielstad, Eileen Png, Sarah J Dunstan, Nguyen Van Vinh Chau, Jinxin Bei, Yi Xin Zeng, Abhilasha Karkey, Buddha Basnyat, Francesca Pasutto, Daniela Paoli, Paolo Frezzotti, Jie Jin Wang, Paul Mitchell, John H Fingert, R Rand Allingham, Michael A Hauser, Soon Thye Lim, Soo Hong Chew, Richard P Ebstein, Anavaj Sakuntabhai, Kyu Hyung Park, Jeeyun Ahn, Greet Boland, Harm Snippe, Richard Stead, Raquel Quino, Su Nyunt Zaw, Urszula Lukasik, Rohit Shetty, Mimiwati Zahari, Hyoung Won Bae, Nay Lin Oo, Toshiaki Kubota, Anita Manassakorn, Wing Lau Ho, Laura Dallorto, Young Hoon Hwang, Christine A Kiire, Masako Kuroda, Zeiras Eka Djamal, Jovell Ian M Peregrino, Arkasubhra Ghosh, Jin Wook Jeoung, Tung S Hoan, Nuttamon Srisamran, Thayanithi Sandragasu, Saw Htoo Set, Vi Huyen Doan, Shomi S Bhattacharya, Ching-Lin Ho, Donald T Tan, Ramanjit Sihota, Seng-Chee Loon, Kazuhiko Mori, Shigeru Kinoshita, Anneke I den Hollander, Raheel Qamar, Ya-Xing Wang, Yik Y Teo, E-Shyong Tai, Curt Hartleben-Matkin, David Lozano-Giral, Seang Mei Saw, Ching-Yu Cheng, Juan C Zenteno, Chi Pui Pang, Huong T T Bui, Owen Hee, Jamie E Craig, Deepak P Edward, Michiko Yonahara, Jamil Miguel Neto, Maria L Guevara-Fujita, Liang Xu, Robert Ritch, Ahmad Tajudin Liza-Sharmini, Tien Y Wong, Saleh Al-Obeidan, Nhu Hon Do, Periasamy Sundaresan, Clement C Tham, Paul J Foster, Lingam Vijaya, Kei Tashiro, Eranga N Vithana, Ningli Wang, Tin Aung

Genome-wide association study identifies five new susceptibility loci for primary angle closure glaucoma

Nature Genetics , April 04, 2016

PubMed ID: 27064256 DOI: 10.1038/ng.3540

Did we miss your publication?

Have you published using HPA040505? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch