Enhanced Validation

Anti-FCGRT Antibody

Fc fragment of IgG, receptor, transporter, alpha
Recommended Applications
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human FCGRT
Alternative Gene Names
alpha-chain, FCRN
Price
$437.00
Product Number
HPA012122
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
Fc fragment of IgG, receptor, transporter, alpha
Target gene
FCGRT
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKS
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000020583 (73%)

Mouse ENSMUSG00000003420 (72%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:5000 - 1:10000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Protocols
Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Recombinant expression validation in WB using target protein overexpression.

Protein Name
Fc fragment of IgG, receptor, transporter, alpha
Gene Name
FCGRT
Alternative Gene Names
alpha-chain, FCRN
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000104870 on the Human Protein Atlas

Alberio T, Forlani G, Lualdi M, Tosi G, Accolla RS, Fasano M

Neonatal Fc receptor is involved in the protection of fibrinogen after its intake in peripheral blood mononuclear cells

J Transl Med , 2018 Mar 14; 16:64. Epub 2018 Mar 14

PubMed ID: 29540212 DOI: 10.1186/s12967-018-1446-2

Wu L, Chen M, Mao H, Wang N, Zhang B, Zhao X, Qian J, Xing C

Albumin-based nanoparticles as methylprednisolone carriers for targeted delivery towards the neonatal Fc receptor in glomerular podocytes

Int J Mol Med , 2017 Feb 21; 39(4):851-860. Epub 2017 Feb 21

PubMed ID: 28259932 DOI: 10.3892/ijmm.2017.2902

Ko SY, Pegu A, Rudicell RS, Yang ZY, Joyce MG, Chen X, Wang K, Bao S, Kraemer TD, Rath T, Zeng M, Schmidt SD, Todd JP, Penzak SR, Saunders KO, Nason MC, Haase AT, Rao SS, Blumberg RS, Mascola JR, Nabel GJ

Enhanced neonatal Fc receptor function improves protection against primate SHIV infection

Nature , 2014 Oct 30; 514(7524):642-645. Epub 2014 Aug 13

PubMed ID: 25119033 DOI: 10.1038/nature13612

Baker K, Rath T, Flak MB, Arthur JC, Chen Z, Glickman JN, Zlobec I, Karamitopoulou E, Stachler MD, Odze RD, Lencer WI, Jobin C, Blumberg RS

Neonatal Fc Receptor Expression in Dendritic Cells Mediates Protective Immunity Against Colorectal Cancer

Immunity , 2013 Dec 12; 39(6):1095-1107. Epub 2013 Nov 27

PubMed ID: 24290911 DOI: 10.1016/j.immuni.2013.11.003

Seijsing J, Lindborg M, Löfblom J, Uhlén M, Gräslund T

Robust expression of the human neonatal Fc receptor in a truncated soluble form and as a full-length membrane-bound protein in fusion with eGFP.

PLoS One , 2013; 8(11):e81350. Epub 2013 Nov 18

PubMed ID: 24260574 DOI: 10.1371/journal.pone.0081350

Did we miss your publication?

Have you published using HPA012122? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more