Enhanced Validation

Anti-FBXW8 Antibody

F-box and WD repeat domain containing 8
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human FBXW8
Alternative Gene Names
FBW6, FBW8, FBX29, FBXO29
Price
$445.00
Product Number
HPA038851
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
F-box and WD repeat domain containing 8
Target Gene
FBXW8
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KLIFQECRAKEHMLQTNWKNRKGAVSELEHVPDTVLCDVHSHDGVVIAGYTSGDVRVWDTRTWDYVAPFLESEDEEDEPGMQPNVSFVRINSSLAVAA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000032867 (89%)

Rat ENSRNOG00000001126 (87%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
F-box and WD repeat domain containing 8
Gene Name
FBXW8
Alternative Gene Names
FBW6, FBW8, FBX29, FBXO29
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000174989 on the Human Protein Atlas

Halbach MV, Stehning T, Damrath E, Jendrach M, Şen NE, Başak AN, Auburger G

Both Ubiquitin Ligases FBXW8 and PARK2 Are Sequestrated into Insolubility by ATXN2 PolyQ Expansions, but Only FBXW8 Expression Is Dysregulated

PLoS One , 2015; 10(3):e0121089. Epub 2015 Mar 19

PubMed ID: 25790475 DOI: 10.1371/journal.pone.0121089

Fahlbusch FB, Dawood Y, Hartner A, Menendez-Castro C, Nögel SC, Tzschoppe A, Schneider H, Strissel P, Beckmann MW, Schleussner E, Ruebner M, Dörr HG, Schild RL, Rascher W, Dötsch J

Cullin 7 and Fbxw 8 expression in trophoblastic cells is regulated via oxygen tension: implications for intrauterine growth restriction?

J Matern Fetal Neonatal Med , 2012 Nov; 25(11):2209-15. Epub 2012 May 14

PubMed ID: 22524683 DOI: 10.3109/14767058.2012.684166

Did we miss your publication?

Have you published using HPA038851? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch