Enhanced Validation

Polyclonal Anti-FBP1 Antibody

fructose-1,6-bisphosphatase 1
References (9)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human FBP1
Alternative Gene Names
FBP
Open Datasheet
Price
$505.00
Product Number
HPA005857
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemistry analysis in human liver and skeletal muscle tissues using HPA005857 antibody. Corresponding FBP1 RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Western blot analysis in human liver tissue.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
fructose-1,6-bisphosphatase 1
Target Gene
FBP1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000069805 (90%)

Rat ENSRNOG00000017597 (88%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA005857 on the Human Protein Atlas
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
fructose-1,6-bisphosphatase 1
Gene Name
FBP1
Alternative Gene Names
FBP
UniProt ID
P09467
Gene (Ensembl)
ENSG00000165140
Entrez Gene ID
Entrez gene: 2203
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000165140 on the Human Protein Atlas

Sakuma I, Nagano H, Hashimoto N, Fujimoto M, Nakayama A, Fuchigami T, Taki Y, Matsuda T, Akamine H, Kono S, Kono T, Yokoyama M, Nishimura M, Yokote K, Ogasawara T, Fujii Y, Ogawa S, Lee E, Miki T, Tanaka T

Identification of genotype–biochemical phenotype correlations associated with fructose 1,6-bisphosphatase deficiency

Commun Biol , 2023 Jul 28; 6:787. Epub 2023 Jul 28

PubMed ID: 37507476 DOI: 10.1038/s42003-023-05160-y

Liu Z, You Y, Chen Q, Li G, Pan W, Yang Q, Dong J, Wu Y, Bei JX, Pan C, Li F, Li B

Extracellular vesicle-mediated communication between hepatocytes and natural killer cells promotes hepatocellular tumorigenesis

Mol Ther , 2021 Oct 1; 30(2):606-620. Epub 2021 Oct 1

PubMed ID: 34601133 DOI: 10.1016/j.ymthe.2021.07.015

Akhtar S, Culver SA, Siragy HM

Novel regulation of renal gluconeogenesis by Atp6ap2 in response to high fat diet via PGC1-α/AKT-1 pathway

Sci Rep , 2021 May 31; 11:11367. Epub 2021 May 31

PubMed ID: 34059756 DOI: 10.1038/s41598-021-90952-7

Lampert F, Stafa D, Goga A, Soste MV, Gilberto S, Olieric N, Picotti P, Stoffel M, Peter M

The multi-subunit GID/CTLH E3 ubiquitin ligase promotes cell proliferation and targets the transcription factor Hbp1 for degradation

eLife , 2018 Jun 18; 7:e35528. Epub 2018 Jun 18

PubMed ID: 29911972 DOI: 10.7554/eLife.35528

Guo B, Huang X, Lee MR, Lee SA, Broxmeyer HE

Antagonism of PPARγ signaling expands human hematopoietic stem and progenitor cells by enhancing glycolysis

Nat Med , 2018 Jan 29; 24(3):360-367. Epub 2018 Jan 29

PubMed ID: 29377004 DOI: 10.1038/nm.4477

Gutteridge RE, Singh CK, Ndiaye MA, Ahmad N

Targeted knockdown of polo-like kinase 1 alters metabolic regulation in melanoma

Cancer Lett , 2017 Feb 22; 394:13-21. Epub 2017 Feb 22

PubMed ID: 28235541 DOI: 10.1016/j.canlet.2017.02.013

Brooks SA, Khandani AH, Fielding JR, Lin W, Sills T, Lee Y, Arreola A, Milowsky MI, Wallen EM, Woods ME, Smith AB, Nielsen ME, Parker JS, Lalush DS, Rathmell WK

Alternate metabolic programs define regional variation of relevant biological features in renal cell carcinoma progression

Clin Cancer Res , 2016 Jan 19; 22(12):2950-2959. Epub 2016 Jan 19

PubMed ID: 26787754 DOI: 10.1158/1078-0432.CCR-15-2115

Li B, Qiu B, Lee DS, Walton ZE, Ochocki JD, Mathew LK, Mancuso A, Gade TP, Keith B, Nissim I, Simon MC

Fructose-1, 6-bisphosphatase opposes renal carcinoma progression

Nature , 2014 Sep 11; 513(7517):251-255. Epub 2014 Jul 20

PubMed ID: 25043030 DOI: 10.1038/nature13557

Did we miss your publication?

Have you published using HPA005857? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-FBP1 (HPA012513)
Corresponding Antigens
PrEST Antigen FBP1 (APrEST70322)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch