Anti-FBF1 Antibody

Fas (TNFRSF6) binding factor 1
References (8)
Recommended Applications
Product Description
Polyclonal Antibody against Human FBF1
Alternative Gene Names
ALB, FBF-1, FLJ00103, KIAA1863
Open Datasheet
Price
$450.00
Product Number
HPA023677
Unit Size
Concentration
Lot dependent
Availability
8 in Stock
Ships
Ready to Ship
Show all images
[3 pictures]
Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line A549 shows localization to centrosome.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
Fas (TNFRSF6) binding factor 1
Target Gene
FBF1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ARTKSLLGDDVFSTMAGLEEADAEVSGISEADPQALLQAMKDLDGMDADILGLKKSNSAPSKKAAKDPGKGELPNHP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000008577 (44%)

Mouse ENSMUSG00000020776 (44%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Protein Name
Fas (TNFRSF6) binding factor 1
Gene Name
FBF1
Alternative Gene Names
ALB, FBF-1, FLJ00103, KIAA1863
UniProt ID
Q8TES7
Gene (Ensembl)
ENSG00000188878
Entrez Gene ID
Entrez gene: 85302
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000188878 on the Human Protein Atlas

SAHABANDU N, KONG D, MAGIDSON V, NANJUNDAPPA R, SULLENBERGER C, MAHJOUB MR, LONCAREK J

Expansion microscopy for the analysis of centrioles and cilia

J Microsc , 2019 Nov 19; 276(3):145-159. Epub 2019 Nov 19

PubMed ID: 31691972 DOI: 10.1111/jmi.12841

Tu HQ, Qin XH, Liu ZB, Song ZQ, Hu HB, Zhang YC, Chang Y, Wu M, Huang Y, Bai YF, Wang G, Han QY, Li AL, Zhou T, Liu F, Zhang XM, Li HY

Microtubule asters anchored by FSD1 control axoneme assembly and ciliogenesis

Nat Commun , 2018 Dec 11; 9:5277. Epub 2018 Dec 11

PubMed ID: 30538248 DOI: 10.1038/s41467-018-07664-2

Kanie T, Abbott KL, Mooney NA, Plowey ED, Demeter J, Jackson PK

The CEP19-RABL2 GTPase complex binds IFT-B to initiate intraflagellar transport at the ciliary base

Dev Cell , 2017 Jun 15; 42(1):22-36.e12. Epub 2017 Jun 15

PubMed ID: 28625565 DOI: 10.1016/j.devcel.2017.05.016

Airik R, Schueler M, Airik M, Cho J, Ulanowicz KA, Porath JD, Hurd TW, Bekker-Jensen S, Schrøder JM, Andersen JS, Hildebrandt F

SDCCAG8 Interacts with RAB Effector Proteins RABEP2 and ERC1 and Is Required for Hedgehog Signaling

PLoS One , 2016 May 25; 11(5):e0156081. Epub 2016 May 25

PubMed ID: 27224062 DOI: 10.1371/journal.pone.0156081

Kong D, Farmer V, Shukla A, James J, Gruskin R, Kiriyama S, Loncarek J

Centriole maturation requires regulated Plk1 activity during two consecutive cell cycles

J Cell Biol , 2014 Sep 29; 206(7):855-865

PubMed ID: 25246616 DOI: 10.1083/jcb.201407087

Jodoin JN, Shboul M, Albrecht TR, Lee E, Wagner EJ, Reversade B, Lee LA

The snRNA-processing complex, Integrator, is required for ciliogenesis and dynein recruitment to the nuclear envelope via distinct mechanisms

Biol Open , 2013 Dec 15; 2(12):1390-1396. Epub 2013 Nov 12

PubMed ID: 24285713 DOI: 10.1242/bio.20136981

Jakobsen L, Vanselow K, Skogs M, Toyoda Y, Lundberg E, Poser I, Falkenby LG, Bennetzen M, Westendorf J, Nigg EA, Uhlen M, Hyman AA, Andersen JS

Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.

EMBO J , 2011 Apr 20; 30(8):1520-35. Epub 2011 Mar 11

PubMed ID: 21399614 DOI: 10.1038/emboj.2011.63

Did we miss your publication?

Have you published using HPA023677? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens
PrEST Antigen FBF1 (APrEST75961)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch