Enhanced Validation

Anti-F13A1 Antibody

coagulation factor XIII, A1 polypeptide
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human F13A1
Alternative Gene Names
F13A
Price
$445.00
Product Number
HPA001804
Unit Size
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target Protein
coagulation factor XIII, A1 polypeptide
Target Gene
F13A1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LNVTSVHLFKERWDTNKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPVPIVSELQSGKWGAKIVMREDRSVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETDT
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000039109 (87%)

Rat ENSRNOG00000015957 (87%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
coagulation factor XIII, A1 polypeptide
Gene Name
F13A1
Alternative Gene Names
F13A
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000124491 on the Human Protein Atlas

Almgren P, Lindqvist A, Krus U, Hakaste L, Ottosson-Laakso E, Asplund O, Sonestedt E, Prasad RB, Laurila E, Orho-Melander M, Melander O, Tuomi T, Holst JJ, Nilsson PM, Wierup N, Groop L, Ahlqvist E

Genetic determinants of circulating GIP and GLP-1 concentrations

JCI Insight , 2017 Nov 2; 2(21):e93306. Epub 2017 Nov 2

PubMed ID: 29093273 DOI: 10.1172/jci.insight.93306

Azimi A, Pernemalm M, Frostvik Stolt M, Hansson J, Lehtiö J, Egyházi Brage S, Hertzman Johansson C

Proteomics analysis of melanoma metastases: association between S100A13 expression and chemotherapy resistance

Br J Cancer , 2014 May 13; 110(10):2489-2495. Epub 2014 Apr 10

PubMed ID: 24722184 DOI: 10.1038/bjc.2014.169

Kato BS, Nicholson G, Neiman M, Rantalainen M, Holmes CC, Barrett A, Uhlén M, Nilsson P, Spector TD, Schwenk JM

Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model

Proteome Sci , 2011 Nov 17; 9:73. Epub 2011 Nov 17

PubMed ID: 22093360 DOI: 10.1186/1477-5956-9-73

Did we miss your publication?

Have you published using HPA001804? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch