Anti-ERBB2 Antibody

erb-b2 receptor tyrosine kinase 2
Recommended Applications
Product Description
Polyclonal Antibody against Human ERBB2
Alternative Gene Names
CD340, HER-2, HER2, NEU, NGL
Price
$445.00
Product Number
HPA001383
Unit Size
100 µl
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
erb-b2 receptor tyrosine kinase 2
Target Gene
ERBB2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000062312 (82%)

Rat ENSRNOG00000006450 (81%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
erb-b2 receptor tyrosine kinase 2
Gene Name
ERBB2
Alternative Gene Names
CD340, HER-2, HER2, NEU, NGL
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000141736 on the Human Protein Atlas

Seigel GM, Shah DK, Mendoza P, Szalai E, Grossniklaus H, Song Y, Shan J

In situ analysis of Her2 DNA and RNA in retinoblastoma and adjacent retina

Oncoscience , 2019 Aug 23; 6(7-8):357-366. Epub 2019 Aug 23

PubMed ID: 31608299 DOI: 10.18632/oncoscience.489

Sousa DC, Zoroquiain P, Orellana ME, Dias AB, Esposito E, Burnier MN Jr

HER2 Overexpression in Retinoblastoma: A Potential Therapeutic Target?

Ocul Oncol Pathol , 2017 Feb 23; 3(3):210-215. Epub 2017 Feb 23

PubMed ID: 29230390 DOI: 10.1159/000455871

Seigel GM, Sharma S, Hackam AS, Shah DK

HER2/ERBB2 immunoreactivity in human retinoblastoma

Tumour Biol , 2015 Nov 27; 37(5):6135-6142. Epub 2015 Nov 27

PubMed ID: 26614428 DOI: 10.1007/s13277-015-4475-y

Newie I, Søkilde R, Persson H, Grabau D, Rego N, Kvist A, von Stedingk K, Axelson H, Borg Å, Vallon-Christersson J, Rovira C

The HER2-Encoded miR-4728-3p Regulates ESR1 through a Non-Canonical Internal Seed Interaction

PLoS One , 2014; 9(5):e97200. Epub 2014 May 14

PubMed ID: 24828673 DOI: 10.1371/journal.pone.0097200

Huvila J, Talve L, Carpén O, Edqvist PH, Pontén F, Grénman S, Auranen A

Progesterone receptor negativity is an independent risk factor for relapse in patients with early stage endometrioid endometrial adenocarcinoma.

Gynecol Oncol , 2013 Sep; 130(3):463-9. Epub 2013 Jun 15

PubMed ID: 23777659 DOI: 10.1016/j.ygyno.2013.06.015

Did we miss your publication?

Have you published using HPA001383? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch