Polyclonal Anti-EMX1 Antibody

empty spiracles homeobox 1
Recommended Applications
Product Description
Polyclonal Antibody against Human EMX1
Price
$459.00
Product Number
HPA006421
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
empty spiracles homeobox 1
Target Gene
EMX1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRI
Verified Species Reactivity
Human, Mouse
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000033726 (97%)

Rat ENSRNOG00000015493 (95%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Protocols
Protein Name
empty spiracles homeobox 1
Gene Name
EMX1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000135638 on the Human Protein Atlas

Velasco S, Kedaigle AJ, Simmons SK, Nash A, Rocha M, Quadrato G, Paulsen B, Nguyen L, Adiconis X, Regev A, Levin JZ, Arlotta P

Individual brain organoids reproducibly form cell diversity of the human cerebral cortex

Nature , 2019 Jun 5; 570(7762):523-527. Epub 2019 Jun 5

PubMed ID: 31168097 DOI: 10.1038/s41586-019-1289-x

Lancaster MA, Corsini NS, Wolfinger S, Gustafson EH, Phillips A, Burkard TR, Otani T, Livesey FJ, Knoblich JA

Guided self-organization and cortical plate formation in human brain organoids

Nat Biotechnol , 2017 May 31; 35(7):659-666. Epub 2017 May 31

PubMed ID: 28562594 DOI: 10.1038/nbt.3906

Quadrato G, Nguyen T, Macosko EZ, Sherwood JL, Yang SM, Berger D, Maria N, Scholvin J, Goldman M, Kinney J, Boyden ES, Lichtman J, Williams ZM, McCarroll SA, Arlotta P

Cell diversity and network dynamics in photosensitive human brain organoids

Nature , 2017 Apr 26; 545(7652):48-53. Epub 2017 Apr 26

PubMed ID: 28445462 DOI: 10.1038/nature22047

Lancaster MA, Renner M, Martin CA, Wenzel D, Bicknell LS, Hurles ME, Homfray T, Penninger JM, Jackson AP, Knoblich JA

Cerebral organoids model human brain development and microcephaly

Nature , 2013 Sep 19; 501(7467):10.1038/nature1. Epub 2013 Aug 28

PubMed ID: 23995685 DOI: 10.1038/nature12517

Did we miss your publication?

Have you published using HPA006421? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch