Anti-EFNB2 Antibody

ephrin-B2
Recommended Applications
Product Description
Polyclonal Antibody against Human EFNB2
Alternative Gene Names
EPLG5, Htk-L, HTKL, LERK5, MGC126226, MGC126227, MGC126228
Price
$437.00
Product Number
HPA008999
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
ephrin-B2
Target gene
EFNB2
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
YRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000014648 (97%)

Mouse ENSMUSG00000001300 (97%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
ephrin-B2
Gene Name
EFNB2
Alternative Gene Names
EPLG5, Htk-L, HTKL, LERK5, MGC126226, MGC126227, MGC126228
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000125266 on the Human Protein Atlas

Lagares D, Ghassemi-Kakroodi P, Tremblay C, Santos A, Probst CK, Franklin A, Santos DM, Grasberger P, Ahluwalia N, Montesi SB, Shea BS, Black KE, Knipe R, Blati M, Baron M, Wu B, Fahmi H, Gandhi R, Pardo A, Selman M, Wu J, Pelletier JP, Martel-Pelletier J, Tager AM, Kapoor M

ADAM10-mediated ephrin-B2 shedding promotes myofibroblast activation and organ fibrosis

Nat Med , 2017 Oct 23; 23(12):1405-1415. Epub 2017 Oct 23

PubMed ID: 29058717 DOI: 10.1038/nm.4419

Chen S, Bremer AW, Scheideler OJ, Na YS, Todhunter ME, Hsiao S, Bomdica PR, Maharbiz MM, Gartner ZJ, Schaffer DV

Interrogating cellular fate decisions with high-throughput arrays of multiplexed cellular communities

Nat Commun , 2016 Jan; 7:10309. Epub 2016 Jan 12

PubMed ID: 26754526 DOI: 10.1038/ncomms10309

Nakayama A, Nakayama M, Turner CJ, Höing S, Lepore JJ, Adams RH

Ephrin-B2 controls PDGFRβ internalization and signaling

Genes Dev , 2013 Dec 1; 27(23):2576-2589

PubMed ID: 24298057 DOI: 10.1101/gad.224089.113

Nakayama M, Nakayama A, van Lessen M, Yamamoto H, Hoffmann S, Drexler HC, Itoh N, Hirose T, Breier G, Vestweber D, Cooper JA, Ohno S, Kaibuchi K, Adams RH

Spatial regulation of VEGF receptor endocytosis in angiogenesis

Nat Cell Biol , 2013 Mar; 15(3):249-260. Epub 2013 Jan 27

PubMed ID: 23354168 DOI: 10.1038/ncb2679

Did we miss your publication?

Have you published using HPA008999? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch