Anti-DIS3L Antibody

DIS3 like exosome 3'-5' exoribonuclease
Recommended Applications
Product Description
Polyclonal Antibody against Human DIS3L
Alternative Gene Names
DIS3L1, FLJ38088, KIAA1955, MGC4562
Price
$450.00
Product Number
HPA041805
Unit Size
Concentration
Lot dependent
Availability
6 in Stock
Ships
Ready to Ship
Target Protein
DIS3 like exosome 3'-5' exoribonuclease
Target Gene
DIS3L
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LRNLLKDARHDCILFANEFQQCCYLPRERGESMEKWQTRSIYNAAVWYYHHCQDRMPIVMVTEDEEAIQQYGSETEGVFVITFKNYLDNFWPDLKAAHE
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000010537 (93%)

Mouse ENSMUSG00000032396 (91%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Protein Name
DIS3 like exosome 3'-5' exoribonuclease
Gene Name
DIS3L
Alternative Gene Names
DIS3L1, FLJ38088, KIAA1955, MGC4562
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000166938 on the Human Protein Atlas

Kalisiak K, Kuliński TM, Tomecki R, Cysewski D, Pietras Z, Chlebowski A, Kowalska K, Dziembowski A

A short splicing isoform of HBS1L links the cytoplasmic exosome and SKI complexes in humans

Nucleic Acids Res , 2016 Sep 26; 45(4):2068-2080. Epub 2016 Sep 26

PubMed ID: 28204585 DOI: 10.1093/nar/gkw862

Tomecki R, Drazkowska K, Kucinski I, Stodus K, Szczesny RJ, Gruchota J, Owczarek EP, Kalisiak K, Dziembowski A

Multiple myeloma-associated hDIS3 mutations cause perturbations in cellular RNA metabolism and suggest hDIS3 PIN domain as a potential drug target

Nucleic Acids Res , 2014 Jan; 42(2):1270-1290. Epub 2013 Oct 21

PubMed ID: 24150935 DOI: 10.1093/nar/gkt930

Did we miss your publication?

Have you published using HPA041805? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch