Polyclonal Anti-DHDDS Antibody

dehydrodolichyl diphosphate synthase
References (2)
Recommended Applications
Product Description
Polyclonal Antibody against Human DHDDS
Alternative Gene Names
DS, FLJ13102, HDS, RP59
Open Datasheet
Price
$505.00
Product Number
HPA026721
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[1 pictures]
Immunohistochemical staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
dehydrodolichyl diphosphate synthase
Target Gene
DHDDS
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCFAYTSRHEISNA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000012117 (91%)

Rat ENSRNOG00000014665 (91%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Protocols
View all protocols
Protein Name
dehydrodolichyl diphosphate synthase
Gene Name
DHDDS
Alternative Gene Names
DS, FLJ13102, HDS, RP59
UniProt ID
Q86SQ9
Gene (Ensembl)
ENSG00000117682
Entrez Gene ID
Entrez gene: 79947
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000117682 on the Human Protein Atlas

Zelinger L, Banin E, Obolensky A, Mizrahi-Meissonnier L, Beryozkin A, Bandah-Rozenfeld D, Frenkel S, Ben-Yosef T, Merin S, Schwartz SB, Cideciyan AV, Jacobson SG, Sharon D

A Missense Mutation in DHDDS, Encoding Dehydrodolichyl Diphosphate Synthase, Is Associated with Autosomal-Recessive Retinitis Pigmentosa in Ashkenazi Jews

Am J Hum Genet , 2011 Feb 11; 88(2):207-215

PubMed ID: 21295282 DOI: 10.1016/j.ajhg.2011.01.002

Did we miss your publication?

Have you published using HPA026721? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-DHDDS (HPA026727)
Corresponding Antigens
PrEST Antigen DHDDS (APrEST76691)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch