Enhanced Validation

Anti-DDX43 Antibody

DEAD (Asp-Glu-Ala-Asp) box polypeptide 43
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human DDX43
Alternative Gene Names
CT13, DKFZp434H2114, HAGE
Price
$445.00
Product Number
HPA031381
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
DEAD (Asp-Glu-Ala-Asp) box polypeptide 43
Target Gene
DDX43
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GIDTAFQPSVGKDGSTDNNVVAGDRPLIDWDQIREEGLKWQKTKWADLPPIKKNFYKESTATSAMSKVEADSWR
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000070291 (65%)

Rat ENSRNOG00000050868 (65%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
DEAD (Asp-Glu-Ala-Asp) box polypeptide 43
Gene Name
DDX43
Alternative Gene Names
CT13, DKFZp434H2114, HAGE
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000080007 on the Human Protein Atlas

Talwar T, Vidhyasagar V, Qing J, Guo M, Kariem A, Lu Y, Singh RS, Lukong KE, Wu Y

The DEAD-box protein DDX43 (HAGE) is a dual RNA-DNA helicase and has a K-homology domain required for full nucleic acid unwinding activity

J Biol Chem , 2017 May 3; 292(25):10429-10443. Epub 2017 May 3

PubMed ID: 28468824 DOI: 10.1074/jbc.M117.774950

Abdel-Fatah TM, McArdle SE, Johnson C, Moseley PM, Ball GR, Pockley AG, Ellis IO, Rees RC, Chan SY

HAGE (DDX43) is a biomarker for poor prognosis and a predictor of chemotherapy response in breast cancer

Br J Cancer , 2014 May 13; 110(10):2450-2461. Epub 2014 Apr 22

PubMed ID: 24755885 DOI: 10.1038/bjc.2014.168

Did we miss your publication?

Have you published using HPA031381? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch